Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:135,145
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:25%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: UniForum Association
Owner's E-Mail:Login to show email

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2017
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-

Search on skinrenewal (
Match: One


Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info

Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.

0a. lastupdate :
0b. emailsource :
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain :
1b. action :
1c. Registrar : WA Networks
2a. registrant : IAN BROWN
2b. registrantpostaladdress: 70 6th street Parkhurts,Witspos, Gauteng, 2196, ZA
2c. registrantstreetaddress:
2d. amount :
2e. paymenttype :
2f. billingaccount :
2g. billingemail :
2i. invoiceaddress :
2j. registrantphone : +27.767923310
2k. registrantfax : +27.767923310
2l. registrantemail : Login to show email
vat :
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 2006/02/15 11:22:49
4a. admin :
4b. admintitle :
4c. admincompany :
4d. adminpostaladdr :
4e. adminphone :
4f. adminfax :
4g. adminemail :
4h. adminnic :
5a. tec :
5b. tectitle :
5c. teccompany :
5d. tecpostaladdr :
5e. tecphone :
5f. tecfax :
5g. tecemail :
5h. tecnic :
6a. primnsfqdn :
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn :
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn :
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :

Next Query - Domain name
Please refer to the CO.ZA contact details should you have any problems

Who hosts is hosted by HETZNER in Gauteng, Johannesburg, South Africa, 2041. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:HETZNER
Hosted Country:South AfricaZA
Location Latitude:-26.2023
Location Longitude:28.0436
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 31 Jul 2015 23:31:14 GMT
Server: Apache
X-Powered-By: PHP/5.4.41-0 deb7u1
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding
Last-Modified: Fri, 31 Jul 2015 23:31:16 GMT
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

shapingnewsadvicedermal fillershair removalmedicineafricahttpswwwskinrenewalcozaelserenewalsleepdoctorsprogrammenewslettercentremigraine tmjmatriskininfusionmensolutionssoftpdo0 opacityantiageing treatmentsscarsleepsocial investmentskin problemsacnerenewalhealthoutaugust 2017 newsletteropenplatelet richsocial investment 2015visitpeelscar reductionskincare productsaestheticfillersneedlingmediaskinceuticalssloyaltyinitiativeradiantbruxism migrainepearloasis spadocumentcreateelementscriptfitzpatrick skin typefitzpatrickveincape townpeelsdark skininvestmentintegrativeyourmesoglowgenesisanimalricheventsumhlangaoasismeetsaggingfaceliftplatelet rich plasmafitzpatrick skinopacity 1 400our doctors4skin renewal0 opacity 1obagilightbranchesmorenewsletter is outdermarollerlamelleleftspafacerich plasmacorporate social investmentmaleupproductsgetsliderloyalty programmefunction varneostratamedicalloss ageingrangejohannesburgbruxismmigrainedwellsouth africaeventinjectable treatmentsaesthetic clinicsdualfacialshealthwiderenewal aesthetic clinicsrange of medicalbodytruereductionvein removalinjectablesvampiretreatmentsgautenglaser hair1 400renewal aestheticageingonlineaugust 2017facial platelet richjawlinesocial initiativepagervampire facialleft 0 opacityskin problemsdarkfacial plateletopacity 1rejuvenationknowdownloadcssatonloadcarboxytherapytmjlogyoutownopacitycorporatelaser hair removaltreatments for menskin needlingweightdermalmeet ourtextjavascriptmesotherapysouththreadingthisreadystatetypesskincarehealth renewal3hyperhidrosislossiffeet1wide rangepretoriaplateletcorporate social initiativeliquidrenewal whichour supportsandtonsupport2017 newsletterauguststoreotherskin renewal aesthetic5under eyedark2conditionsskin typeourcapeplasmaclinicfraxellaser treatmentsgrooming0beautyinjectablehair losspartiskineyelidskin laser treatmentsivlaservampire facial plateletdamagedwebsiteclinicsincluding6problemsdarkremovaleyesocialliquid faceliftfunctionskin typeshomefacialampskin skinthreadliftskintypeproblemsneedleneckwhichrenewalbrainrenewalantiageingbraincorporate socialdurbaninvestment 2015hairvarplasma eyelidleft 03dundertherapyvisit the websiteskin laser

Longtail Keyword Density for

fitzpatrick skin type6
visit the website5
left 0 opacity4
opacity 1 4004
skin renewal aesthetic4
0 opacity 14
laser hair removal4
facial platelet rich4
corporate social investment4
vampire facial platelet4
platelet rich plasma3
corporate social initiative3
treatments for men3
social investment 20153
renewal aesthetic clinics3
skin laser treatments3
august 2017 newsletter3
newsletter is out3
range of medical3
skin renewal32
skin type12
dark skin9
corporate social8
meet our8
cape town7
hair removal6
fitzpatrick skin6
under eye5
oasis spa5
laser hair5
loss ageing4
renewal aesthetic4
opacity 14
1 4004
skin types4
0 opacity4
left 04
august 20174
loyalty programme4
social investment4
social initiative4
facial platelet4
platelet rich4
skin problems4
vampire facial4
dermal fillers4
laser treatments3
liquid facelift3
2017 newsletter3
injectable treatments3
function var3
skin needling3
bruxism migraine3
migraine tmj3
skin skin3
skin problems-dark3
skin laser3
vein removal3
investment 20153
health renewal3
rich plasma3
scar reduction3
plasma eyelid3
hair loss3
wide range3
skincare products3
renewal which3
our support3
anti-ageing treatments3
south africa3
aesthetic clinics3
our doctors3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Africa South Africa Africa South Africa Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?