Skyhub.com.br Website Analysis Summary

Skyhub.com.br  |  
Low trust score  | 
SkyHub | Integração com marketplace e gestão simplificada


Rank
14,169
Rating
C
Trust Score
Low Trust Score
Estimated worth
$1,073,520
Estimated daily income
$1,491
Estimated monthly income
$45,351
Backlinks
0

Skyhub.com.br has a Low Trust Score, and a Statvoo Rank of C.

Skyhub.com.br is hosted by Unified Layer in Utah, Provo, United States, 84606.
Skyhub.com.br has an IP Address of 198.57.148.94 and a hostname of 198-57-148-94.unifiedlayer.com.

The domain skyhub.com.br was registered 6 years 6 months 5 days ago by BR-NIC, it was last modified 4 years 7 months 3 weeks ago and currently is set to expire 2 years 6 months 1 week ago.

It is the world's 14,169 most popular site among over 300 million websites.

Skyhub.com.br has a total of 0 backlinks.

Skyhub.com.br gets approximately 124,215 unique visitors a day and 745,290 pageviews per day.

Skyhub.com.br has an estimated worth of $1,073,520.
An average daily income of approximately $1,491, which is wroughly $45,351 per month.

Whois information for skyhub.com.br

Full Whois Lookup for Skyhub.com.br Whois Lookup

% Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2017-09-06 20:03:00 (BRT -03:00)

domain: skyhub.com.br
owner: BIT SERVICES
ownerid: 19.760.622/0001-46
responsible: Controlador de Dominios
country: BR
owner-c: SISTE12
admin-c: SISTE12
tech-c: TEGRS
billing-c: SISTE12
nserver: chuck.ns.cloudflare.com
nsstat: 20170902 AA
nslastaa: 20170902
nserver: fay.ns.cloudflare.com
nsstat: 20170902 AA
nslastaa: 20170902
saci: yes
created: 20130813 #11855036
changed: 20170807
expires: 20180813
status: published

nic-hdl-br: SISTE12
person: SIEVE SERVICOS DE TECNOLOGIA
e-mail: Login to show email
BR
created: 20120730
changed: 20170601

nic-hdl-br: TEGRS
person: Tecnologia GRSI
e-mail: Login to show email
BR
created: 20090605
changed: 20170106

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.

Who hosts Skyhub.com.br?

Skyhub.com.br Web Server Information

Hosted IP Address:198.57.148.94
Hosted Hostname:198-57-148-94.unifiedlayer.com
Service Provider:Unified Layer
Hosted Country:United StatesUS
Location Latitude:40.2139
Location Longitude:-111.634
Webserver Software:Not Applicable

HTTP Header Analysis for Skyhub.com.br

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.8.0
Date: Tue, 28 Jul 2015 07:06:08 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Pingback: http://skyhub.com.br/xmlrpc.php
Link:; rel=shortlink
Content-Encoding: gzip

Need to find out who hosts Skyhub.com.br?

Skyhub.com.br Free SEO Report

Website Inpage Analysis for Skyhub.com.br

H1 Headings:0
H2 Headings:4
Você conhece o modelo de Marketplace?
Por que integrar com marketplaces?
Parceiros SkyHub
Pronto para vender nos maiores Marketplaces da internet?Clique no botão abaixo e comece agora mesmo!
H3 Headings:0
H4 Headings:5
Aumente e escale as vendas
Otimize o tempo de gestão
Controle seus produtos
Contato Comercial
Suporte técnico
H5 Headings:0
H6 Headings:0
Total IFRAMEs:2
Total Images:33
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Skyhub.com.br

wpageheadnav wpageheadnavhcontatowtimelinetypevertical31c5c7 fadethead thwnavanchorgpaginationitem31c5c7 fade elementscoloralternate widgetwidgetarchivetfoot tdwidgetwidgetcategorieswpricingitemtitlewnavanchorlevel2emwnavlistlayoutverwidgetwidgettagcloudwtagslayoutblock wtagsitemlinkhover429edb coloralternatewlanglayoutdropdownmarketplaceswidgetwidgetnavmenubordercoloralternate selectwidgetwidgetrecententries ulbackgroundcolor ebf0f0wclientsnavwfiltersitemlinkwpcalendar theadwidgetwidgetcategories ul libeforewblogentryformatgallerywblogentrylinkhover wblogentrypreviewicon wblogimgposatleftwnavlistlayoutver wnavanchor24pxwblogentrymetacommentslsubfooterattop widgetwidgetcategories ulinputtypepassword coloralternatelsubfooterattop widgetwidgetarchiveahover lsubfooterattopwblogentryformatquotewpcalendar tbodywidgetwidgettagcloud tagcloud ahoverhoverwshortblogentrymetadatelinkwpageheadnavhcoloralternate inputtypetext coloralternatee8e8e8fontsize0 2pxwclientsnav coloralternatewblogentrylinkhoverhover colortextarea selectlifontfamilythwiconboxicontop wiconboxh0wpageheadcolor 31c5c7ewblogimgposatleft wblogentryformatgalleryfontweightwtimelineitemwidgetwidgetnavmenu menuitemcitealternate5429edb insetcoloralternate widgetwidgetarchive ulwpcalendar tbody tdinset coloralternatewtagsitemlinkfade elements colorwnavanchorlevel3ul li spanwblogentrymetatagswtimelinetypevertical wtimelinesectioncontentwpcalendar thead thwidgetwidgetrecententries ul liwpageheadnavskyhubtfootwiconboxhinputtypetext coloralternateboxshadow 0spanbordercolor e8e8e8coloralternate inputtypetextcolor 999999tagcloud ahover colorwidgetwidgetrss ulwnavanchorlevel1429edbcoloralternate wblogtypemasonrylsubfooterattop widgetwidgetnavmenu menuitemtextareacoloralternate wclientsnav coloralternatewnavanchorlevel3 lsubheaderatmiddlewblogimgposatleft wblogentryformatquotewlanglistahovercoloralternate wclientsnavhoverlsubfooterattop widgetwidgetcategorieswidgetwidgetnavmenu menuitem abeforewidgetwidgetarchive ulwnavanchorlevel2 lsubheaderatmiddlemenuitem a colorwblogimgposatleft wblogentryformatstatuswidgetwidgetarchivewtimelinesectiontitlefffffflsubheaderatmiddleh2color 666666wiconboxiconlsubfooterattop widgetwidgetnavmenucoloralternate select coloralternateh3wsearchsubmitinsidewidgetwidgetnavmenu menuitem ahovercoloralternate inputtypepasswordwtagsitemlinkhoverborder colorwpricingitempricetextwblogimgposatleft wblogentryformatlinktext fontbackgroundcolor ffffffh44coloralternate wtagslayoutblockwblogentryformatvideowblogentryformatstatuswblogentrylinkhover wblogentrypreviewiconwtimelinesectioncontentbackgroundlsubfooterattop widgetwidgetarchive ulinputtypetext inputtypepassword inputtypeemail3pxtagcloud a colorwnavtitlewblogimgposatleftmenuitem abeforeinputtypetext coloralternate inputtypepasswordselectferramentacolor lsubheaderattopcolorwidgetwidgetrsswclientsnavhover coloralternatewshortblogentrytitlehmenuitemli citewidgetwidgettagcloud tagcloudlibeforewpcalendarffffff border color0 0coloralternate wclientsnavhover coloralternateh5coloralternate widgetwidgetnavmenu menuitem10 0 2pxtextarea coloralternate selectcoloralternate widgetwidgetcategories ulli ahoverwblogimgposatleft wblogentryformatvideoinputtypepasswordlineheightcoloralternate inputtypeemail31c5c7oabeforecoloralternate wpcalendarcoloralternate widgetwidgetnavmenuinputtypetextcoloralternate textarea coloralternatetagcloud20pxahover color 31c5c7wblogimgposatleft wblogentryformataudiowpcalendar tfootbackground colornavigationalternate backgroundcolor coloralternatewblogentryformatlink2pxactivebordercolorwidgetwidgetrecententriesinputtypeemail textarea selecttbodyheading colorli span0 0 0ffffff borderh1colorprimary wiconboxicontopmenuitem ahoverheader6theadostext colorcoloralternateboxshadow 0 0insetplsubfooterattopwfiltersitemactive wfiltersitemlinkcoloralternate inputtypeemail coloralternatewblogentrymetadateulwsocialsitemlinkcoloralternate wnavlistlayoutverlsubheaderattopnoswfiltersitemactivetextarea coloralternateselect coloralternatecoloralternate inputtypepassword coloralternatewlanglayoutdropdown wlanglistlsubfooteratbottom5pxinputtypetext inputtypepasswordwblogtypemasonry wblogentrymetacolorprimaryinputtypeemailcolor lsubfooterattopcoloralternate ghrhwblogentryformataudiowpcalendar tfoot tdcoloralternate textareawidgetwidgetcategories ulwidgetwidgetcategories ul liinputtypeemail textareawblogentrypreviewiconlsubfooterattop wpcalendarcoloralternate wtabsitemactivetagcloud ahoverwtabslayoutaccordionwclientsnavhoverfontahover colorwiconboxicontopinputtypepassword inputtypeemaildddddd3coloralternate wtabslayoutaccordioninputtypeemail coloralternateahover coloralternatewblogentrypreviewicon wblogimgposatleft wblogentryformatlinkfadeelements colorul libeforewidgetwidgetarchive ul libeforegbtntypedefaultwblogentrymetaauthorghrhul li citeul liwtagslayoutblockcoloralternate wclientsnavwblogentrypreviewicon wblogimgposatleft wblogentryformatvideotbody tdghtmlcolor 429edbebf0f0h6bodyul li ahoverinputtypepassword inputtypeemail textareafontweight 400333333 insetwidgetwidgetrss ul licoloralternate widgetwidgetcategorieswidgetwidgetarchive ul liwportfolioitemmeta30pxboxshadowdisplaywblogentrypreviewicon wblogimgposatleft wblogentryformatstatusinputtypeemail coloralternate textareacoloralternate wiconboxicontopcolor lsubfooteratbottomcoloralternate wportfolioitemmetaelementsloginwblogentrystickybackgroundcolor 31c5c7wblogentrymetafade elementstdwblogentrypreviewicon wblogimgposatleft wblogentryformatquotecoloralternate wtimelinetypeverticalwblogtypemasonryalternate background colorwblogentrypreviewicon wblogimgposatleftwblogentrypreviewicon wblogimgposatleft wblogentryformatgallerywnavanchorlevel1 lsubheaderatmiddleheadinginputtypepassword coloralternate inputtypeemail2backgroundcolorwtabsitemactive

Longtail Keyword Density for Skyhub.com.br

KeywordsOccurences
box-shadow 0 016
0 0 016
widgetwidgetcategories ul li6
widgetwidgetarchive ul li6
ul li ahover6
ul li span6
widgetwidgetrss ul li6
wp-calendar thead th6
0 0 2px6
coloralternate widgetwidgetnavmenu menu-item5
widgetwidgetnavmenu menu-item ahover5
w-blog-entry-linkhover w-blog-entry-preview-icon w-blogimgposatleft5
l-subfooterattop widgetwidgetnavmenu menu-item4
fade elements color4
ahover color 31c5c74
coloralternate inputtypepassword coloralternate3
inputtypepassword coloralternate inputtypeemail3
inputtypetext coloralternate inputtypepassword3
coloralternate w-clients-nav coloralternate3
l-subfooterattop widgetwidgetarchive ul3
coloralternate inputtypeemail coloralternate3
coloralternate inputtypetext coloralternate3
coloralternate widgetwidgetcategories ul3
l-subfooterattop widgetwidgetcategories ul3
tagcloud a color3
coloralternate select coloralternate3
ffffff border color3
coloralternate widgetwidgetarchive ul3
textarea coloralternate select3
coloralternate w-clients-navhover coloralternate3
coloralternate textarea coloralternate3
inputtypeemail coloralternate textarea3
31c5c7 fade elements3
w-blog-entry-preview-icon w-blogimgposatleft w-blog-entryformat-quote3
w-blog-entry-preview-icon w-blogimgposatleft w-blog-entryformat-status3
w-blog-entry-preview-icon w-blogimgposatleft w-blog-entryformat-video3
w-blog-entry-preview-icon w-blogimgposatleft w-blog-entryformat-link3
w-blog-entry-preview-icon w-blogimgposatleft w-blog-entryformat-gallery3
inputtypetext inputtypepassword inputtypeemail3
inputtypepassword inputtypeemail textarea3
inputtypeemail textarea select3
wp-calendar tbody td3
wp-calendar tfoot td3
widgetwidgetcategories ul libefore3
widgetwidgetnavmenu menu-item abefore3
widgetwidgetrecententries ul li3
widgetwidgetarchive ul libefore3
alternate background color3
menu-item a color3
widgetwidgettagcloud tagcloud ahover3
tagcloud ahover color3
ul li cite3
0 032
ul li21
box-shadow 017
w-blog-entry-preview-icon w-blogimgposatleft15
widgetwidgetnavmenu menu-item14
w-nav-anchorlevel2 l-subheaderatmiddle11
w-nav-anchorlevel3 l-subheaderatmiddle10
background color9
widgetwidgetcategories ul9
widgetwidgetarchive ul9
w-nav-anchorlevel1 l-subheaderatmiddle9
color coloralternate8
color l-subfooterattop7
w-iconboxicontop w-iconbox-h7
coloralternate widgetwidgetnavmenu7
coloralternate w-blogtypemasonry7
wp-calendar thead6
thead th6
ul libefore6
widgetwidgetrss ul6
li span6
widgetwidgettagcloud tagcloud6
li ahover6
0 2px6
w-blog-entry-linkhover w-blog-entry-preview-icon6
color 9999996
background-color ffffff5
menu-item ahover5
color 31c5c75
coloralternate w-nav-listlayoutver5
ahover coloralternate5
color l-subfooteratbottom5
border color5
coloralternate wp-calendar4
text color4
color l-subheaderattop4
color 6666664
coloralternate w-tabslayoutaccordion4
fade elements4
ahover color4
border-color e8e8e84
w-blogtypemasonry w-blog-entry-meta4
429edb inset4
elements color4
333333 inset4
w-nav-listlayoutver w-nav-anchor4
coloralternate w-iconboxicontop4
l-subfooterattop wp-calendar4
w-timelinetypevertical w-timeline-section-content4
ahover l-subfooterattop4
colorprimary w-iconboxicontop4
l-subfooterattop widgetwidgetnavmenu4
font-weight 4003
alternate background3
textarea coloralternate3
coloralternate select3
coloralternate textarea3
inputtypeemail coloralternate3
inputtypetext coloralternate3
coloralternate inputtypepassword3
inputtypepassword coloralternate3
coloralternate inputtypeemail3
l-subfooterattop widgetwidgetcategories3
select coloralternate3
coloralternate inputtypetext3
coloralternate w-portfolio-item-meta3
coloralternate widgetwidgetarchive3
coloralternate widgetwidgetcategories3
429edb coloralternate3
ffffff border3
coloralternate w-clients-navhover3
l-subfooterattop widgetwidgetarchive3
w-clients-navhover coloralternate3
inset coloralternate3
coloralternate w-tagslayoutblock3
widgetwidgetrecententries ul3
wp-calendar tbody3
background-color ebf0f03
w-blogimgposatleft w-blog-entryformat-video3
tbody td3
wp-calendar tfoot3
w-pagehead-nav w-pagehead-nav-h3
tfoot td3
w-blogimgposatleft w-blog-entryformat-status3
w-blogimgposatleft w-blog-entryformat-quote3
textarea select3
inputtypeemail textarea3
w-blogimgposatleft w-blog-entryformat-audio3
inputtypetext inputtypepassword3
w-blogimgposatleft w-blog-entryformat-link3
w-blogimgposatleft w-blog-entryformat-gallery3
color 429edb3
background-color 31c5c73
w-langlayoutdropdown w-lang-list3
li cite3
inputtypepassword inputtypeemail3
coloralternate g-hr-h3
coloralternate w-clients-nav3
coloralternate w-tabs-itemactive3
w-clients-nav coloralternate3
menu-item abefore3
31c5c7 fade3
hover color3
heading color3
text font3
w-filters-itemactive w-filters-item-link3
w-tagslayoutblock w-tags-item-linkhover3
tagcloud ahover3
coloralternate w-timelinetypevertical3
coloralternate168
color65
052
l-subheaderatmiddle50
l-subfooterattop32
ul27
ahover21
li21
w-blog-entry-preview-icon18
w-blogimgposatleft18
widgetwidgetnavmenu18
box-shadow17
background-color16
w-blogtypemasonry14
menu-item14
inset13
wp-calendar12
w-nav-anchorlevel211
w-nav-anchorlevel111
429edb11
w-iconboxicontop11
w-nav-anchorlevel311
31c5c710
w-nav-listlayoutver10
border-color10
110
font-size9
widgetwidgetcategories9
background9
widgetwidgetarchive9
ffffff9
skyhub9
g-html8
w-tabslayoutaccordion8
line-height8
td8
w-blog-entry-linkhover8
w-iconbox-h7
h17
e8e8e87
text7
w-timelinetypevertical6
26
2px6
w-clients-navhover6
w-timeline-section-title6
w-portfolio-item-meta6
w-tabs-itemactive6
thead6
inputtypepassword6
inputtypeemail6
inputtypetext6
th6
select6
textarea6
ferramenta6
w-nav-anchor6
tagcloud6
widgetwidgettagcloud6
span6
l-subheaderattop6
libefore6
e6
widgetwidgetrss6
border6
g-hr-h6
w-clients-nav6
h45
h35
h25
w-tagslayoutblock5
w-filters-item-link5
w-pricing-item-title5
body5
ebf0f05
marketplaces5
w-searchsubmitinside5
h55
w-tags-item-linkhover5
35
colorprimary5
w-langlayoutdropdown5
l-subfooteratbottom5
contato5
h65
dddddd4
w-blog-entry-meta-date4
link4
w-blog-entry-meta4
w-iconbox-icon4
w-shortblog-entry-title-h4
w-blog-entry-meta-author4
w-pagehead4
w-blog-entry-meta-tags4
w-blog-entry-meta-comments4
g-btntypedefault4
fade4
alternate4
elements4
w-socials-item-link4
44
nos4
20px4
p4
navigation4
heading4
30px4
g-pagination-item4
54
font-weight4
w-timeline-item4
w-shortblog-entry-meta-date4
w-tags-item-link4
w-blog-entrysticky4
display4
w-timeline-section-content4
login3
os3
o3
5px3
cite3
63
w-nav-title3
em3
w-blog-entryformat-link3
w-lang-list3
hover3
active3
w-pagehead-nav3
header3
w-pricing-item-price3
font3
font-family3
24px3
w-pagehead-nav-h3
w-blog-entryformat-audio3
tfoot3
w-filters-itemactive3
3px3
abefore3
tbody3
w-blog-entryformat-video3
w-blog-entryformat-gallery3
w-blog-entryformat-quote3
w-blog-entryformat-status3
widgetwidgetrecententries3

What are the nameservers for skyhub.com.br?

Skyhub.com.br Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown