Home

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 198,649
Estimated Worth: $45,900
Category: Health

We provide the widest range of NHS mental health services in the UK. We also provide substance misuse services for people who are addicted to drugs or alcohol.



Domain summary

Last updated
2021-05-09
Domain label
slam
Domain extension
nhs.uk
Global Traffic Rank
198,649
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$45,900
Estimated daily income
$85
Estimated monthly income
$2,585

Frequently Asked Questions (FAQ)

Q: When was Slam.nhs.uk registered?
A: Slam.nhs.uk was registered 6 months, 4 weeks, 8 hours, 7 minutes, 18 seconds ago on Sunday, May 9, 2021.
Q: When was the WHOIS for Slam.nhs.uk last updated?
A: The WHOIS entry was last updated 6 months, 4 weeks, 8 hours, 7 minutes, 18 seconds ago on Sunday, May 9, 2021.
Q: What are Slam.nhs.uk's nameservers?
A: DNS for Slam.nhs.uk is provided by the following nameservers:
  • ns-1296.awsdns-34.org
  • ns-715.awsdns-25.net
  • ns-321.awsdns-40.com
  • ns-1777.awsdns-30.co.uk
Q: Who is the registrar for the Slam.nhs.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Slam.nhs.uk?
A: Slam.nhs.uk ranks 198,649 globally on Alexa. Slam.nhs.uk has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Slam.nhs.uk each day?
A: Slam.nhs.uk receives approximately 7,567 visitors and 30,268 page impressions per day.
Q: What IP address does Slam.nhs.uk resolve to?
A: Slam.nhs.uk resolves to the IPv4 address 107.162.145.148.
Q: In what country are Slam.nhs.uk servers located in?
A: Slam.nhs.uk has servers located in the United States.
Q: What webserver software does Slam.nhs.uk use?
A: Slam.nhs.uk is powered by webserver.
Q: Who hosts Slam.nhs.uk?
A: Slam.nhs.uk is hosted by Defense.Net, Inc in United States.
Q: How much is Slam.nhs.uk worth?
A: Slam.nhs.uk has an estimated worth of $45,900. An average daily income of approximately $85, which is roughly $2,585 per month.

Slam.nhs.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Slam.nhs.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Slam.nhs.uk

H1 Headings

8 :
  1. One millionth vaccine delivered to Maudsley Hospital  
  2. One millionth vaccine delivered to Maudsley Hospital  
  3. Coronavirus (Covid-19)
  4. Coronavirus (Covid-19)
  5. Congratulations to our HSJ award winners
  6. Congratulations to our HSJ award winners
  7. Maudsley Learning 
  8. Maudsley Learning 

H2 Headings

3 :
  1. Our hospitals
  2. Twitter feed
  3. Latest news

H3 Headings

7 :
  1. Follow Us
  2. @MaudsleyNHS
  3. How to find us
  4. Patient leaflets
  5. Our services
  6. Contact us
  7. PALS line

H4 Headings

0 :

H5 Headings

2 :
  1. Consultant Psychiatrist Dr Gene-Cos speaks to Ian Wright for BBC One documentary
  2. Actor Tuppence Middleton talks to OCD expert Dr Gazal Jones for BBC Radio 4 

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

38 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-40895755-1

Links - Internal

262:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Slam.nhs.uk

partnerscareers ourcharity our historylewishamcarerspatientsawardsnowleafletsfindgtprivacycareaddictionscontactcentretrainingcharityone millionthhistoryhospitalelseneed helpmediadebuggercovid19researchmaudsley hospitalfind usour1varboroughhelpselyoureducationequalityfind us needlearningmorehistory findeast londonnationalmentaladvicefacemaudsley learningmillionthrefsupportadolescent servicesinformationbbcduringdisordersfunctiongallerydisordercovid19 informationservicesyouour charityfeedbackus needsouthwarkvaccineonlinehonoraryserviceour servicesresourcesour historyoutout moreus need helpifcroydonone millionth vaccinedeliveredsouth londonstaffhelp noweastlondonneedddlmaudsleycharity ourmillionth vaccinedebugger varmental health0returntraining and developmentpartnershipcareerspeoplesearchsfvalneed help nowcoursescareers our charitycontact uschild and adolescentcommunitylambethduring covid19our history findcoronavirussouthcamhsanyusecookieshealthadolescentweotherdrchildstaff awardspatientsouth eastsouth east londondevelopmentout more gtfind out morefind outhistory find usqualityusour charity ouronemore gtsearchvolunteeringevents

Longtail Keyword Density for Slam.nhs.uk

KeywordsOccurences
out more gt8
find out more4
careers our charity4
our charity our4
charity our history4
our history find4
history find us4
need help now4
child and adolescent4
one millionth vaccine4
find us need3
us need help3
training and development3
south east london3
mental health11
out more10
more gt8
find us7
our services6
south london5
our history5
find out4
millionth vaccine4
one millionth4
during covid-194
maudsley hospital4
help now4
need help4
history find4
charity our4
our charity4
careers our4
us need3
adolescent services3
maudsley learning3
staff awards3
contact us3
south east3
east london3
covid-19 information3
debugger var3
our34
services20
health16
maudsley15
us15
hospital12
find12
more12
mental11
var11
service10
out10
camhs9
gt9
if9
london9
south8
08
information8
help8
lambeth8
support7
training7
any7
covid-197
function7
disorder6
one6
ddl6
croydon6
carers6
history6
child5
adolescent5
learning5
15
search5
lewisham5
need5
national5
we5
else5
disorders5
advice5
equality5
southwark5
now5
patient5
charity5
quality5
people5
debugger4
face4
delivered4
contact4
patients4
research4
community4
development4
your4
other4
return4
coronavirus4
careers4
care4
staff4
during4
vaccine4
events4
partnership4
ref4
millionth4
sel3
borough3
searchsfval3
dr3
cookies3
east3
online3
use3
you3
resources3
feedback3
partners3
gallery3
addictions3
courses3
media3
education3
centre3
volunteering3
honorary3
awards3
privacy3
leaflets3
bbc3

Who hosts Slam.nhs.uk?

Slam.nhs.uk Hosting Provider Information

Hosted IP Address:107.162.145.148
Hosted Hostname:107.162.145.148
Service Provider:Defense.Net, Inc
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "Defense.Net, Inc" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
Defense.Net, Inc
0.0109%

HTTP Header Analysis for Slam.nhs.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Date: Sun, 09 May 2021 03:10:39 GMT
Content-Length: 134674
Via: 1.1 lon1-bit8

Slam.nhs.uk Domain Nameserver Information

HostIP AddressCountry
ns-1296.awsdns-34.org 205.251.197.16
ns-715.awsdns-25.net 205.251.194.203
ns-321.awsdns-40.com 205.251.193.65
ns-1777.awsdns-30.co.uk 205.251.198.241


Need to find out who hosts Slam.nhs.uk?


Domain Registration (WhoIs) information for Slam.nhs.uk

 Error for "slam.nhs.uk".

Nominet is not the registry for this domain name.

WHOIS lookup made at 04:10:39 09-May-2021

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2021.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Slam-app.engineer
slam-app.engineer -&nbspslam app Resources and Information.
Slam-burger.com
SlamBurger Alum Rock, Ward End, Birmingham, Takeaway Order Online - SlamBurger Alum Rock
Slam-canada.com
SLAM Canada – SUPPORTING LOCAL AREA MUSICANS
Slam-city.com
SLAM CITY

Recently Updated Websites

Stabiatourism.it (6 seconds ago.)Liveharborpointe.com (12 seconds ago.)Togosrestaurant.com (14 seconds ago.)Freyja.is (14 seconds ago.)Occitanieatable.com (15 seconds ago.)Mwe.cn (16 seconds ago.)Aylatreecare.com (16 seconds ago.)Digitalassetfool.com (19 seconds ago.)Mp3songlist.com (24 seconds ago.)Steroidchart.com (25 seconds ago.)Leavenworthpowersports.com (29 seconds ago.)Declaration-cession-vehicule.fr (30 seconds ago.)Vavi.com.vn (32 seconds ago.)Singularence.com (35 seconds ago.)Appcharcha.com (35 seconds ago.)Thevoicethatlistens.com (38 seconds ago.)Discover.if.ua (41 seconds ago.)Iban.vn (44 seconds ago.)Murgers.com (45 seconds ago.)Sanatteorisi.net (46 seconds ago.)Rewiredcapital.com (46 seconds ago.)Conwaysportsperformance.com (46 seconds ago.)Rxave.com (51 seconds ago.)Abloc.online (52 seconds ago.)4flonghorns.com (54 seconds ago.)Stackworks.org (59 seconds ago.)Playsex.info (1 minute 1 second ago.)Ninza.in (1 minute 2 seconds ago.)Betaform.shop (1 minute 3 seconds ago.)Roseknox-peebles.com (1 minute 3 seconds ago.)

Recently Searched Keywords

greedy+1984 (1 second ago.)путеводители по объектам юнеско (1 second ago.)一字解特馬 (1 second ago.)new typeerrorcannot (2 seconds ago.)binda (2 seconds ago.)učenički dom (5 seconds ago.)bo daftar (7 seconds ago.)frgor och (7 seconds ago.)hpa to psi (8 seconds ago.)一周会议 (9 seconds ago.)atelier forma de pudim (10 seconds ago.)sereturnsfunctiontypeof symbolsymboltypeof symboliteratorfunctionereturn (10 seconds ago.)kraftverk (10 seconds ago.)mlinarska cesta 35 (10 seconds ago.)brošura (12 seconds ago.)25px margin-top (14 seconds ago.)coaching leadership style (15 seconds ago.)massage therapy courses (16 seconds ago.)mytoys bei pinterest (17 seconds ago.)bring a little sunshine into the home with one of our beautiful plants shop all plants (17 seconds ago.)langen (17 seconds ago.)nowid (18 seconds ago.)scrollpic02framewidth (19 seconds ago.)dyrekcja (19 seconds ago.)strictnrtndtroutefunctionreturn andtcontentfunctionreturn (22 seconds ago.)poklu august (22 seconds ago.)psychoterapia kraków (23 seconds ago.)inactentertainment (25 seconds ago.)atk models (26 seconds ago.)efunctiontypeof symboleconstructorsymbolesymbolprototypesymboltypeof (26 seconds ago.)