|  National Sleep Foundation - Sleep Research & Education
Low trust score  | 
Explore the National Sleep foundation, your source for sleep research and education from sleep disorders and problems to polls and maximizing energy. Website Information has a Low Trust Score, a Statvoo Rank of C, an Alexa Rank of 45,207, a Majestic Rank of 3,833, a Domain Authority of 82% and is listed in DMOZ. is hosted by Media Temple, Inc. in California, Culver City, United States, 90232. has an IP Address of and a hostname of

The domain was registered 2 decades 2 years 7 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.

Whois information for

Full Whois Lookup for Whois Lookup

Registry Domain ID: D105193-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-09-14T07:28:52Z
Creation Date: 1996-11-12T05:00:00Z
Registry Expiry Date: 2019-11-11T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID: C123370417-LROR
Registrant Name: Perfect Privacy, LLC
Registrant Organization:
Registrant Street: 12808 Gran Bay Parkway West
Registrant Street: care of Network Solutions
Registrant Street: PO Box 459
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32258
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C122308246-LROR
Admin Name: Perfect Privacy, LLC
Admin Organization:
Admin Street: 12808 Gran Bay Parkway West
Admin Street: care of Network Solutions
Admin Street: PO Box 459
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32258
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C2454571-LROR
Tech Name: Stephen Wilcox
Tech Organization: Network Solutions, LLC.
Tech Street: 13861 SUNRISE VALLEY DR
Tech City: Herndon
Tech State/Province: VA
Tech Postal Code: 20171-6124
Tech Country: US
Tech Phone: +1.8886429675
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS44.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-23T18:56:02Z

Who hosts Web Server Information

Hosted IP Address:
Service Provider:Media Temple, Inc.
Hosted Country:United StatesUS
Location Latitude:34.0172
Location Longitude:-118.393
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 28 May 2015 08:55:01 GMT
Server: Apache
X-Powered-By: PleskLin
X-Drupal-Cache: HIT
Etag: "1432796775-1"
Content-Language: en
X-Generator: Drupal 7 (
Cache-Control: public, max-age=0
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Vary: Cookie,Accept-Encoding
Content-Encoding: gzip
Last-Modified: Thu, 28 May 2015 07:06:15 GMT
MS-Author-Via: DAV
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-2767497219341454
Google Analytics:Not Applicable

Keyword Cloud for

sleep apneaduringbeforesleep disorderstravelingnational sleep foundationwhilebetter sleepneedshouldkeepcouldmorethesesleeplearnampherenationalkidsdisorderswhyfindiffoundationyourconnection betweensosleeporgbedgetskipoutstressconnectionyou shouldtravelnational sleepapneaelectronicstroublesleep foundationmaybetteryou canbetweenbefore bedbutsleepingviewkeyhelpnightsvargoodyour sleepcanyou

Longtail Keyword Density for

national sleep foundation4
sleep disorders4
national sleep4
sleep foundation4
you should3
your sleep3
connection between3
better sleep3
you can3
sleep apnea3
before bed3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?