NEW SMC Expertise - Passion - Automation

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 153,598
Estimated Worth: $87,600

SMC



Domain summary

Last updated
2021-04-06
Domain label
smc
Domain extension
eu
Global Traffic Rank
153,598
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$87,600
Estimated daily income
$146
Estimated monthly income
$4,441

Frequently Asked Questions (FAQ)

Q: When was Smc.eu registered?
A: Smc.eu was registered 1 year, 6 days, 12 hours, 43 minutes, 55 seconds ago on Saturday, June 13, 2020.
Q: When was the WHOIS for Smc.eu last updated?
A: The WHOIS entry was last updated 1 year, 6 days, 12 hours, 43 minutes, 55 seconds ago on Saturday, June 13, 2020.
Q: What are Smc.eu's nameservers?
A: DNS for Smc.eu is provided by the following nameservers:
  • ns1.cdnetdns.net
  • ns2.cdnetdns.net
Q: Who is the registrar for the Smc.eu domain?
A: The domain has been registered at EURID.
Q: What is the traffic rank for Smc.eu?
A: Smc.eu ranks 153,598 globally on Alexa. Smc.eu has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Smc.eu each day?
A: Smc.eu receives approximately 11,676 visitors and 58,380 page impressions per day.
Q: What IP address does Smc.eu resolve to?
A: Smc.eu resolves to the IPv4 address 213.130.35.105.
Q: In what country are Smc.eu servers located in?
A: Smc.eu has servers located in the United Kingdom.
Q: What webserver software does Smc.eu use?
A: Smc.eu is powered by Nginx/1.10.3 (Ubuntu) webserver.
Q: Who hosts Smc.eu?
A: Smc.eu is hosted by NTT America, Inc. in United Kingdom.
Q: How much is Smc.eu worth?
A: Smc.eu has an estimated worth of $87,600. An average daily income of approximately $146, which is roughly $4,441 per month.

Smc.eu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Smc.eu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Smc.eu

H1 Headings

0 :

H2 Headings

31 :
  1. Our products
  2. Our solutions
  3. Our News & Events
  4. Our company
  5. SMC
  6. My account
  7. You may be as well interested in ...
  8. SMC CAD Catalogue
  9. Innovation interactive catalogue
  10. Wireless fieldbus system
  11. Our services & solutions
  12. Ionizers – “And see the gain” with SMC´s Ionizers
  13. Products for Robotics – Let SMC be your “Right arm”
  14. Energy efficiency – Energise your efficiency with SMC
  15. About SMC
  16. News & press releases
  17. April 2021
  18. March 2021
  19. January 2021
  20. December 2020
  21. October 2020
  22. September 2020
  23. August 2020
  24. June 2020
  25. November 2019
  26. September 2019
  27. Fairs & Events
  28. Compamed 2021
  29. Need help?
  30. Visit us also at
  31. Want to be up-to-date?

H3 Headings

1 :
  1. Reliable partnerships are key, but how to find real trust?

H4 Headings

1 :
  1. No selected elements

H5 Headings

1 :
  1. Barcode Scanner

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

51 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

275:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Smc.eu

discoverexpertsenergisefluid control equipmentproducts vacuummeeting your challengesfrenchswitzerlandmakeredirectresults other languagesalwayscylindersvalvessolenoidenergise youractuatorgeneralsearchport solenoid valvesoursmc0vacuum productsregulatorsinputequipmentatex productshighlighted productsno resultsfluid controlsolutionsyour efficiencystaticfieldbus systemdirectional control valvesnosensors amptemperatureclean roomindustryweexpertiseenergy efficiencyelectric3eventsamp eventsairtemperature controlsensorslocalenameionizersatexgetssiproductsisenterkeyyourcontrol valveslifemoreactuatorsresults otherdirectionalproducts clean roomnew productscontrollerpressurefittingsfunctionsearchlogupsystemtubingprocessroboticsairline equipmentwirelesschallengesfluidampdirectional controltoolsfieldbussolenoid valvesfittings amp tubinggetenginesdataother languagesnewsport solenoidcatalogueoperatedwindowsmcswiftypeengineemeeting yourautomationneedisoneedslanguagescontrollersamp tubingenergy1ifcompanyflowhighsafetyrotarycontrolvarfiltersotherswitchesamp switchesfunction varyour challengessmcgeneralsearchengine2020 smcvalvehighlightedefficiencywindowsmc windowsmccompactvacuumelectric actuatorsfittings amptimesaccessoriesresultsnewworldwidepneumaticsensors amp switchescleanenergise your efficiencyproductsproductiondigitalroomekeycodetypesproducts clean5 portcontrol equipmentsolenoid valvecloseyouwant2porthigh vacuummeetingno results otherthroughproductairlinecustomer

Longtail Keyword Density for Smc.eu

KeywordsOccurences
sensors amp switches4
directional control valves3
port solenoid valves3
fittings amp tubing3
fluid control equipment3
products clean room3
no results other3
results other languages3
energise your efficiency3
meeting your challenges3
highlighted products12
no results6
windowsmc windowsmc6
function var5
airline equipment5
energy efficiency4
new products4
amp switches4
vacuum products4
control equipment4
sensors amp4
2020 smc4
solenoid valves4
port solenoid4
control valves3
your challenges3
meeting your3
your efficiency3
energise your3
other languages3
results other3
electric actuators3
amp events3
directional control3
solenoid valve3
atex products3
fittings amp3
products clean3
high vacuum3
temperature control3
fluid control3
products vacuum3
fieldbus system3
5 port3
amp tubing3
clean room3
var34
products34
smc27
your25
amp18
valves18
you16
vacuum15
our14
windowsmc14
control13
industry13
actuators12
equipment12
highlighted12
solutions10
switches10
air10
function9
new8
08
valve7
efficiency7
solenoid7
worldwide7
system7
port7
no7
results7
airline6
product6
controller6
electric6
times6
if6
we6
ionizers6
pressure5
more5
high5
localename5
temperature5
need5
company5
expertise5
sensors5
15
fieldbus5
catalogue5
other5
automation4
tubing4
energy4
searchlog4
operated4
customer4
static4
close4
actuator4
fluid4
events4
flow4
news4
fittings4
filters4
discover4
smcgeneralsearchengine4
challenges4
production4
controllers4
makeredirect4
safety4
getssiproducts3
e3
generalsearch3
getenginesdata3
switzerland3
through3
swiftypeengine3
french3
meeting3
want3
energise3
input3
languages3
directional3
isenterkey3
pneumatic3
23
digital3
types3
compact3
accessories3
wireless3
rotary3
cylinders3
iso3
regulators3
tools3
ekeycode3
process3
always3
experts3
needs3
clean3
room3
atex3
up3
robotics3
life3
33

Who hosts Smc.eu?

Smc.eu Hosting Provider Information

Hosted IP Address:213.130.35.105
Hosted Hostname:evx4406016-evx4406016-web.sys.ntt.eu
Service Provider:NTT America, Inc.
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:nginx/1.10.3 (Ubuntu)

Is "NTT America, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
NTT America, Inc.
0.0100%

HTTP Header Analysis for Smc.eu

Http-Version: 1.1
Status-Code: 200
Status: 200
Date: Tue, 06 Apr 2021 11:48:53 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: nginx/1.10.3 (Ubuntu)
vary: Origin
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Cache-Control: no-cache, no-store, max-age=0, must-revalidate
Pragma: no-cache
Expires: 0
Strict-Transport-Security: max-age=31536000 ; includeSubDomains
X-Frame-Options: SAMEORIGIN
Content-Security-Policy: frame-ancestors 'self' http://*.brose.net http://brose.net https://*.brose.net https://brose.net https://*.ariba.com https://*.zkw.at http://*.zkw.at https://*.mycatalogcloud.com http://*.mycatalogcloud.com http://*.valeo.determine.com https://*.valeo.determine.com http://valeo.determine.com https://valeo.determine.com https://www.elwitec.ch/
X-Content-Security-Policy: frame-ancestors 'self' http://*.brose.net http://brose.net https://*.brose.net https://brose.net https://*.ariba.com https://*.zkw.at http://*.zkw.at https://*.mycatalogcloud.com http://*.mycatalogcloud.com http://*.valeo.determine.com https://*.valeo.determine.com http://valeo.determine.com https://valeo.determine.com https://www.elwitec.ch/
Content-Encoding: gzip

Smc.eu Domain Nameserver Information

HostIP AddressCountry
ns1.cdnetdns.net 174.35.55.22
ns2.cdnetdns.net 66.114.55.22


Need to find out who hosts Smc.eu?


Domain Registration (WhoIs) information for Smc.eu

 % The WHOIS service offered by EURid and the access to the records
% in the EURid WHOIS database are provided for information purposes
% only. It allows persons to check whether a specific domain name
% is still available or not and to obtain information related to
% the registration records of existing domain names.
%
% EURid cannot, under any circumstances, be held liable in case the
% stored information would prove to be wrong, incomplete or not
% accurate in any sense.
%
% By submitting a query you agree not to use the information made
% available to:
%
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or
% otherwise;
% - target advertising in any possible way;
%
% - to cause nuisance in any possible way to the registrants by sending
% (whether by automated, electronic processes capable of enabling
% high volumes or other possible means) messages to them.
%
% Without prejudice to the above, it is explicitly forbidden to extract,
% copy and/or use or re-utilise in any form and by any means
% (electronically or not) the whole or a quantitatively or qualitatively
% substantial part of the contents of the WHOIS database without prior
% and explicit permission by EURid, nor in any attempt hereof, to apply
% automated, electronic processes to EURid (or its systems).
%
% You agree that any reproduction and/or transmission of data for
% commercial purposes will always be considered as the extraction of a
% substantial part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept
% that EURid can take measures to limit the use of its WHOIS services
% in order to protect the privacy of its registrants or the integrity
% of the database.
%
% The EURid WHOIS service on port 43 (textual whois) never
% discloses any information concerning the registrant.
% Registrant and on-site contact information can be obtained through use of the
% webbased WHOIS service available from the EURid website www.eurid.eu
%
% WHOIS smc.eu
Domain: smc.eu
Script: LATIN

Registrant:
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

On-site(s):
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

Registrar:
Name: Ascio Technologies Inc.
Website: https://www.ascio.com

Name servers:
ns1.cdnetdns.net
ns2.cdnetdns.net

Please visit www.eurid.eu for more info.

Websites with Similar Names

Smc-111.com
BETSMARC
Smc-2.com
大无限彩票平台投注网址 - 首页
Smc-4002100490.com
click.com.cn
Smc-501.com
Welcome To K-SMARC
Smc-55.com
Welcome to K-SMARC
Smc-800.com
Welcome To K-SMARC
Smc-ag.com
Sports Management & Consulting AG - Be Different, Be Real
Smc-airtac-festo.com
2019亚洲男人天堂_色偷偷资源站男人天堂

Recently Updated Websites

Academrespect.ru (3 seconds ago.)Servicedaily00aw74123.monster (4 seconds ago.)Kwiktint.com (4 seconds ago.)Doperollz.com (4 seconds ago.)Newzitiv.com (4 seconds ago.)Classytrashymagazine.net (5 seconds ago.)Mitalgeria.com (6 seconds ago.)Apnesamachar.com (6 seconds ago.)Naturesview.info (6 seconds ago.)Zhengjgroup.com (7 seconds ago.)Fearfreepharmacy.biz (7 seconds ago.)Woodgrainvinyl.com (7 seconds ago.)Veinsonlineschool.com (7 seconds ago.)Petrsoukuptri.com (7 seconds ago.)Dreamstoaction.info (8 seconds ago.)Dashingdowntheroadamerica.org (8 seconds ago.)Pantrygame.com (8 seconds ago.)Baytown.properties (9 seconds ago.)Yansgym.app (9 seconds ago.)Daniel-e-isabela.com (9 seconds ago.)Bingen-sponsheim.de (11 seconds ago.)Epaper.pk (11 seconds ago.)Orientalrecords.com (12 seconds ago.)Pranetinitiative.com (13 seconds ago.)Funkgefluegel.de (14 seconds ago.)Homemadams.club (14 seconds ago.)Mdlotteryhome.com (14 seconds ago.)Zf8g.com (15 seconds ago.)Maisieavery.com (15 seconds ago.)Low-link.com (16 seconds ago.)

Recently Searched Keywords

chicote (1 second ago.)meme görüntüleme (1 second ago.)сертификат ножа корсар.jpg (2 seconds ago.)ishttp2 (2 seconds ago.)fogshield xp® pre-moistened lens cleaning tissues (4 seconds ago.)2sk-1 (5 seconds ago.)generatia 3d (8 seconds ago.)jamil (8 seconds ago.)manufacturing & industrial (9 seconds ago.)organisationsudvikling i hr-perspektiv (10 seconds ago.)weiterbildungen schweiz (10 seconds ago.)barkatullah university result (12 seconds ago.)seguridad alimentaria (12 seconds ago.)items 4 nav (13 seconds ago.)parentid0keywordsnamemenugenitive title (15 seconds ago.) (16 seconds ago.)koelsysteem (16 seconds ago.)menstruation (18 seconds ago.)4-5 2000 eur (18 seconds ago.)4 рец. (18 seconds ago.)pro tips (21 seconds ago.)aarvee capital services (21 seconds ago.)泉州 (24 seconds ago.)sku na (25 seconds ago.)rog 3 (25 seconds ago.)20px14em futura-lt-w01-lightsans-serif (26 seconds ago.)champions league table (27 seconds ago.)naf (28 seconds ago.)hypnobirthing book (31 seconds ago.)weiterbildungen soziale arbeit (32 seconds ago.)