ГЛАВНАЯ | smena98

Safety: Low trust score
Year Founded: 2014
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-28
Category: This site has not been categorized yet


Domain summary

Domain label
smena98
Domain extension
ru
Domain registered:
2014-10-03
Domain updated:
2020-11-28
Domain expires:
2021-10-03
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is smena98.ru ranked relative to other sites:

Percentage of visits to smena98.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Smena98.ru registered?
A: Smena98.ru was registered 6 years, 3 months, 3 weeks, 18 hours, 45 minutes, 32 seconds ago on Friday, October 3, 2014.
Q: When was the WHOIS for Smena98.ru last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 5 days, 18 hours, 45 minutes, 32 seconds ago on Saturday, November 28, 2020.
Q: What are Smena98.ru's nameservers?
A: DNS for Smena98.ru is provided by the following nameservers:
  • ns1.wix.com
  • ns2.wix.com
Q: Who is the registrar for the Smena98.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Smena98.ru?
A: Smena98.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Smena98.ru each day?
A: Smena98.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Smena98.ru resolve to?
A: Smena98.ru resolves to the IPv4 address 23.236.62.147.
Q: In what country are Smena98.ru servers located in?
A: Smena98.ru has servers located in the United States.
Q: What webserver software does Smena98.ru use?
A: Smena98.ru is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Smena98.ru?
A: Smena98.ru is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Smena98.ru worth?
A: Smena98.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Smena98.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Smena98.ru Free SEO Report

Website Inpage Analysis for Smena98.ru

H1 Headings

0 :

H2 Headings

10 :
  1. НОВОСТИ
  2. АНОНСЫ
  3. Наталья Адаменко
  4. СООБЩЕСТВО
  5. Людмила Таболина 
  6. Автор Юрий Королёв
  7. Автор - Лариса Лисова
  8. Наша выпускница, ученица Сан Саныча
  9. в Фонде Карла Буллы.
  10. Александр Петросян

H3 Headings

3 :
  1. Фото Татьяна Галкина
  2. Зоя Тимофеева
  3. Игорь Лебедев. 6.30 утра . По дороге

H4 Headings

3 :
  1. 01
  2. 03
  3. 02

H5 Headings

0 :

H6 Headings

1 :
  1. ШКОЛА ФОТОГРАФИИ «СМЕНА» 

Total IFRAMEs

3 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

22:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Smena98.ru

shqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbuttonecomvc1label4px rgba0borderwidth1px backgroundcolorrgba255shqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbutton12px14em arialwatai1positionstaticboxshadow000 0b0b0b0rgba0rgba0 00 border1px solidlrichtextcontainer04s1transitionbordercolor 04sssg1imageitempanel opacity0255 1borderstylesolidbordercolorrgba163 217margin0lineheightnormalletterspacingnormal1liststyletypesquarelineheightnormal bodyecomatc1labelcontentpositionabsolutebottom50left3pxmargin005s ease 0smdash 199027importantfontnormal normalh6 margin0lineheightnormalletterspacingnormal1 solid 1pxselectdatapreviewerror0 0 05fontsize12pxfontweightboldol olshqgiconleftimagebuttonwithtextbuttonlabel0s coloropacity0nbspnlaquo raquoheightcalc100headingheightcalc100 40pxddm1repeaterbuttondatastatedropright011px14em open3px rgba0oldirrtlshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbuttonbackgroundcolorrgba255 255 255ol ul liststyletypesquarelineheightnormalcolor 05s ease0pxdisplayinlineblockpositionrelative0 1 0pxwhitespacenormalborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolor 04scolor 05s0 0 060 0 05ease 0s borderraquo mdashboxsizingborderbox importantoverflowhiddencursorpointer0px 0 0pxdisplayinlineblockpositionrelative1px 4pxnnsnkvktouchmediazoomimageinfoborderstylesolidbordercolorrgba249 249 249rgba249 249 249shqgiconleftimagebuttonwithtextbuttonicon right0249 249 1backgroundcolorrgba255normal 16px14emrgba108 97contentpositionabsolutetextaligncenterbottom50left20pxwidth20pxheight20pxlineheight20px importantmarginbottom11pxcolorfffbackgroundf00border2px05positionabsolutetop0right0bottom0left0backgroundcolorrgba188 129 1410 0 blackopen sanssansserifh1raquo n97 96colorffffff16px14em times new0 0pxdisplayinlineblockpositionrelativeborderrgba193importantdisplayblockcolor44363410px 10pxnbsp1990positionabsolutetop0right0bottom0left0backgroundcolorrgba255 255lrichtextcontainer uliframe0 borderrgba193ul positionabsolutebottom10pxleft0right0textaligncentercolor0000004pxul ul liststyletypesquarelineheightnormalwidth0importantfontnormal normal normalncontentpositionabsolutebottom50left3pxmargin0 0 7px015simportant heading srichtextcontainerheading37contentpositionabsolutetextaligncenterbottom50left20pxwidth20pxheight20pxlineheight20pxwp1rollover1borderstylesolidbordercolorrgba163paginationnextwebkituserselectnonedisplayinlineblockmsuserselectnonewebkittouchcalloutnonepadding0boxshadow0 1px 1pxsolid rgba51 51borderradius0 positionabsolutetop0right0bottom0left0backgroundcolorrgba188nbspnnimportantborderradius0shqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbutton51 51li padding0marginleft calc100 980pxjustifycontentflexstartrgba249 249importantheight100positionabsolutebottom10pxleft0right0textaligncentercolor000000 importanttimes23ultxtnewpadding0blogh3 margin0lineheightnormalletterspacingnormalbackgroundcolorrgba188 129width100importantoverflowhiddencursorpointer importantsusaawrichtextclickableskinrichtextcontainer ulnn laquo5pxdisplayinlinecalc100 980pxheightcalc100 40px importantborderwidth2px borderstylesolidbordercolorrgba249 249b3labelwrapperpositionabsolutetop0right0bottom0left0backgroundcolorrgba188backgroundcolorrgba0transitioncolorddm1navcontainerarrowddm1navcontainerrightdirectionmargin0lineheightnormalletterspacingnormal txtnewsolid rgba255 255ffffffraquo0s backgroundcolorhelveticaw01boldhelveticaw02boldhelveticaltw10boldsansserifultxtnew olboxsizingborderbox importantbackgroundcolorrgba255ol33246 1positionrelativewidth100 importantheight100 importantdisplayblockbackgroundcolor 04s ease0ecometi1erase1bordercolorrgba0positionabsolutetop0right0bottom0left0rgba68colorfffffftransitioncolor 04s easekeyframesselectdatapreviewfocusshqgiconleftimagebuttonwithtextbuttonlabel displaynoneul olborderradius5pxrgba68 54body lrichtextcontainerpggcg4itemscontainer186 186normal normal 14px14em14ssg1hoverpositionabsolutetop0right0bottom0left0boxsizingborderbox05s980pxcalc100fontstyleinheritfontweightinheritlineheightinheritletterspacingnormalecomatc1labelwrapper186 1 solid255 1borderradius0shqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbutton1backgroundcolorrgba255 255 2551 ddm1navcontainer1 pggcg0gallerydisplayerhoverbackgroundcolorrgba255 255textaligncenterfontnormal normalb3datadisabledfalseactivedatastatemobileshqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbutton255 255 1borderstylesolidbordercolorrgba1631px rgba0 0b1linkssg1buttonspggcg2itemscontainerfontnormal normal normalimportantmarginbottom11pxcolorfffbackgroundf00border2px solid0 0 border1px0 7px 2pxcolorffftextshadow1px44marginleft05pxwidth100tdnormal 16px14em times13positionrelativewidth100linear infinite1 0pxcursorpointer importantssg1helpers3px rgba0 0importantbackgroundcolorrgba255 2553pxcolore4523fnew romantimesserif color00000016sanssansserifp margin0lineheightnormalletterspacingnormallb1itemscontainerul liststyletypediscshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbuttonn n0 rgba0nbspnn laquopositionabsolutetop0right0bottom0left0backgroundcolorrgba255boxsizingborderboxtransparentstylek72d8mcglabelbackgroundcolorffffffborderwidth2px borderstylesolidbordercolorrgba249minwidth10px importantimportantfontsize14pxcolor000000cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur autopaddingright13emmarginright5em body lrichtextcontainer2px000000 0pxcursorpointer10ddm1navcontainerarrowddm1navcontainerleftdirectionssg1pnlheading srichtextcontainer ul186 186 1cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincurshqgiconleftimagebuttonwithtextbuttonicon left031cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpngtransitionopacityopen sanssansserif color443634normal normal 13px14emfffborderradius50boxshadow0importantleftauto importantzindex50shqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbutton1px rgba0normal 11px14emtextaligncenter importantbackgroundcolorrgba0 0 0ul ulnn mdashpadding0 5pxdisplayinline importantfontsize14pxcolor000000normal 12px14em45normal 13px14em times0s boxshadow0 1px40pxpaddingright13emmarginright5em susaawrichtextclickableskinrichtextcontainerb1labelwrapper0s color 05sbackgroundcolorrgba193 186 186quotecomrfc1linklrichtextcontainer olselectfocusromantimesserif0 0 10s boxshadow04ecomco1linkselectdatapreviewerror ddm1navcontainerarrownormal normal255 1borderstylesolidbordercolorrgba163rgba68 54 52importantbackgroundcolorrgba255tblc1ul positionabsolutebottom10pxleft0right0textaligncentercolor000000 important249 1backgroundcolorrgba2551 solidbackgroundcolorrgba16014px14em opensolid rgba68liststyletypecirclelineheightnormalboxsizingborderbox importantfontnormalnbsp nbsptbodylaquonbspnbspselectdatapreviewhoverborderwidth1px1boxsizingborderbox importantborderradius0 boxshadow0liststyletypesquarelineheightnormal heading srichtextcontainerselectnew romantimesserif color000000wordbreakbreakworddisplayinlineblocklineheight1textalignleft important29rgba255boxshadow0 0ddm1navcontainerrightdirectionshysolid rgba5130px14em helveticaw01boldhelveticaw02boldhelveticaltw10boldsansserif255 1boxsizingborderboxminwidth10px38 1bordercolorrgba02px rgba249 249solidshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfourlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincurol ul ultblc1 tbodyurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcurecomatc1linktimes new05s 1ms linearfont normal normal0 05fontsize12pxfontweightboldborderradius0 positionabsolutetop0right0bottom0left0backgroundcolorrgba188 12952 11borderstylesolidbordercolorrgba163 217 246laquo raquodisplaynoneimportantoverflowhiddencursorpointertextareafocusshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabelddm1navcontainerarrowshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbuttonurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock42spanbefore contentpafterh1 margin0lineheightnormalletterspacingnormalh2 margin0lineheightnormalletterspacingnormaln n nbackgroundcolorrgba0 0shqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbuttonli padding0 5pxdisplayinlinebackgroundcolorrgba193spanvl1linesusaawrichtextclickableskinrichtextcontainer olpositionabsolutetop0right0bottom0left0boxsizingborderbox importantbackgroundcolorrgba255autooverflowhiddendisplayblockmdash217 246shqgiconleftimagebuttonwithtextbuttonextrainfo color000000srichtextcontainerheadingecomrfc1labelwrapper1bordercolorrgba0 0 0backgroundcolorrgba188 129 141mdash nlinbspnbsp laquohelveticaw01boldhelveticaw02boldhelveticaltw10boldsansserif transitioncolorsutwetouchmediazoomitemimagecontainerboxshadow0font normalh5photonormal normal 16px14emyearcolor000000transitioncolorsrichtextcontainer olshqgiconleftimagebuttonwithtextbuttonextrainfopmarginleft calc100ul liststyletypecirclelineheightnormal410 0 015ms pgothicdotumhelveticasansserif5shqgiconleftimagebuttonwithtextbuttonicon webkitanimationnameshqgiconleftimagebuttonwithtextheartbeatanimationnameshqgiconleftimagebuttonwithtextheartbeatwebkitanimationduration05sanimationduration05swatai1datastateinvalidcolore4523f importantpositionabsolutetop0right0bottom0left0backgroundcolorrgba188 1290s borderfffborderradius50boxshadow0 1px 3pxboxshadow0 0 0mdash nn255 2550 0 0new romantimesserifborder1px0pxcursorpointer importantimportantminwidth0 importantbackgroundcolorrgba193 186dotted rgba0 0230px14emdotted rgba0b3label36015shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel displaynonendashshqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbutton54 52 1rgba255 255rgba249ol liststyletypedecimalbackgroundcolorrgba188h5 margin0lineheightnormalletterspacingnormal1200 2000ul liststyletypesquarelineheightnormal susaawrichtextclickableskinrichtextcontainerwidth0 importantminwidth0 importantraquo laquo raquotimes new romantimesserif1bordersolid rgba0 02018 nbspnbsp laquoquot quot1boxsizingborderbox importantborderradius0ddm1navcontainerleftdirectionimportant body lrichtextcontainerbodycolor000000transitioncolor 04s easecontentpositionabsolutebottom50left3pxmargin0 0ul ol ulwidth0 importantminwidth0backgroundcolorrgba204 204 2041transitionbordercolor0s bordersolidopenpggcg0gallerydisplayerhover1msecometi1input8 38webkitanimationnameshqgiconleftimagebuttonwithtextheartbeatanimationnameshqgiconleftimagebuttonwithtextheartbeatwebkitanimationduration05sanimationduration05ssnkvktouchmediazoomcentereddivsolid fffborderradius50boxshadow0210 0 rgba0opacity1 ssg1hover0pxcursorpointer26255 1borderradius0 boxshadow030px14em helveticaw01boldhelveticaw02boldhelveticaltw10boldsansserif transitioncolor204 204 1bordersolid0px 0px 0margin0lineheightnormalletterspacingnormal headingpositionfixed importantleftautonormal 13px14emborderleft1px2pxcolorffftextshadow1px 1px0px 0solid rgba10814px14em47rgba108 97 96margin0lineheightnormalletterspacingnormal body lrichtextcontainerborderradius024285pxdisplayinline importantfontsize14pxcolor000000stylek72d8mcglabelwrapperstylek72d98t6labelwrapperfontnormal4px rgba0 0quotquotfontsolid fffborderradius50boxshadow0 1pxease 0stransitioncolor 04s13px14em times newbackgroundcolor ffffff13px14em times431970 mdashnormal normal normalromantimesserif transitioncolor204 1bordersolid rgba01ms linear infinite0 0 borderrgba1930 0importantmarginbottom11pxcolorfffbackgroundf00border2pxnn nnauto129 141heading srichtextcontainer ol0 blackshqgiconleftimagebuttonwithtextbuttontextwrapperbackgroundcolorrgba204photographerpositionabsolutetop0right0bottom0left0transitionbordercolorh4srichtextcontainer ularial ms pgothicdotumhelveticasansserifhc2bgnormal 12px14em arialliststyletypesquarelineheightnormal heading0 7pxborder1px solid rgba01512px14em arial msnormal normal 30px14emuldirrtl18color ffffffliststyletypedecimalpositionabsolutetop0right0bottom0left0transitionbordercolor 04s ease1borderradius014px14em open sanssansserif00000091ms linearshqgiconleftimagebuttonwithtextbuttonicon10pxddm1repeaterbuttonlabelraquo laquospanbefore22helveticaw01boldhelveticaw02boldhelveticaltw10boldsansserif transitioncolor 04srgba51 51 51urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto7px 2pxcolorffftextshadow1px 1pxddm1navcontainerul ul ul05s easeselecthover7pxul liststyletypesquarelineheightnormalimportantborderradius0 boxshadow0 0displayblockboxshadow0 1px0 015ssg1autoplayromantimesserif color0000000px1px97 96 1important body2pxcolorffftextshadow1px 1px 3pximportantminwidth0importantleftautorgba51backgroundcolorrgba204 2041970positionabsolutebottom10pxleft0right0textaligncentercolor000000backgroundcolorrgba2551 0pxcursorpointerul paddingleft13emmarginleft5emlineheightnormalletterspacingnormallaquoraquomargin0lineheightnormalletterspacingnormal body0 06boxsizingborderbox importantoverflowhiddencursorpointer importantease 0s backgroundcolorwacb1left10pxright10pxmargin0lineheightnormalletterspacingnormal susaawrichtextclickableskinrichtextcontainerimportant heading35nbspnlaquoshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo color000000255 1 ddm1navcontainerboxsizingborderbox importantfontnormal normalfffborderradius50boxshadow0 1pxbody lrichtextcontainer oltxtnew ulh4 margin0lineheightnormalletterspacingnormalli fontstyleinheritfontweightinheritlineheightinheritletterspacingnormalborder 05s easeoverflowhidden25ddm1navcontainerarrowddm1navcontainercenterdirectionshqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbutton204 204nn nn nntextaligninitialdisplayflexalignitemscenternormal normal 12px14emheading srichtextcontainersusaawrichtextclickableskinrichtextcontainerpaddingright13emmarginright5em body141 1transitionopacity 05spositionstaticboxshadow000ol ullaquo ndashimportantzindex5020solid rgba68 54textalignright important000000 0pxcursorpointer important11px14em open sanssansserifromantimesserif transitioncolor 04sliststyletypesquarelineheightnormal susaawrichtextclickableskinrichtextcontainerssg1imageitempanelul ul liststyletypecirclelineheightnormalsolid rgba255nbsp nbsp nbsp54 52pgothicdotumhelveticasansserif0sbackgroundcolorrgba160 8rgba51 5138textalignlefteaseddm1navcontainercenterdirectionopacity1 ssg1datastatetouchrollover12px14em0 border1pxbackgroundcolorsolid 1pxcolor000000transitioncolor 04spositionabsolutetop0right0bottom0left0boxsizingborderbox importantbackgroundcolorrgba255 25512ddm1navcontainerarrow ddm1navcontainersvgcontainershqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbuttonspan whitespacenormalborderrgba193 186pggcg0gallerydisplayercursorpointersanssansserif color443634positionabsolutetop0right0bottom0left0backgroundcolorrgba255 255 2550 1 0pxcursorpointer227 227boxshadow0 1px 4pxpggcg3itemscontainerjustifycontentflexendlaquo raquo laquosnkvktouchmediazoomimageimagecontainerh646dotted1px 1pxssg1pnl opacity11backgroundcolorrgba255ease 0s bordersolidliststyletypedisccontentliststyletypesquarelineheightnormal31px 1px rgba01backgroundcolorrgba255 2551970 mdash 1990h21bordercolorrgba0 0borderwidth2pxssg1btnnew romantimesserif transitioncolorborder0h30 rgba0 0importantborderradius0 boxshadow0204 1bordersolidimportantfontnormalpaddingright13emmarginright5em heading srichtextcontainerpositionabsolutetop0right0bottom0left0transitionbordercolor 04sol ol ulinfinite13px14emlaquoraquo laquoraquo laquoraquolaquoraquo laquoraquo2018 nbspnbsp0px 0px8 38 1bordercolorrgba0textalignjustifymarginleftecomvc1labelwrappersolid rgba0app1loading255 1blackcolor000000wordbreakbreakworddisplayinlineblocklineheight10s backgroundcolor 04snormal 14px14em openapp1datastateloadingecomvc1linkcalc100 980px 05solid rgba108 97shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo displaynonearial msimportantbackgroundcolorrgba255 255 2558ulrgba255 255 255186 1cursorpointer importantshqgiconleftimagebuttonwithtextbuttonlabel color000000pggcg1itemscontainerjustifycontentcentershqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbuttonnew3238 1bordercolorrgba0 0borderradiusinheritcontentpositionabsolutetextaligncenterbottom50left20pxwidth20pxheight20pxlineheight20px importantmarginbottom11pxcolorfffbackgroundf00border2px solidmargin0lineheightnormalletterspacingnormal heading srichtextcontainer129 141 1b3datastateshoulduseflex0s border 05sstylek72d98t6labelddm1navcontainersvgcontainerpadding0 5pxdisplayinlinecolorecomco1labelwrapper1transitionbordercolor 04s easelaquo raquo npaddingleft13emmarginleft5emlineheightnormalletterspacingnormal1px 3px0positionrelativewhitespacenowrap34paddingright13emmarginright5em heading1bordersolidimportantlrichtextcontainerbodyul liststyletypesquarelineheightnormal headingcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpngnormal 11px14em openarialrgba0 0 0importantheight100 importantdisplayblockecomti1datastateinvalidimportantmarginbottom11pxcolorfffbackgroundf00border2px solid fffborderradius50boxshadow0normal normal 11px14em0px 0positionrelativewhitespacenowrap19borderstylesolidbordercolorrgba249 249border1px solidpaddingright13emmarginright5em1borderradius0 boxshadow0 1pxborderstylesolidbordercolorrgba249left0border170 borderrgba193 18639217 246 1positionrelativestylek72d5ntybg111px 3px rgba0ease 0s color30heading srichtextcontainerheadingnormal 30px14emnormal 14px14em40positionfixedcolorfffffftransitioncolorease 0s boxshadow01borderstylesolidbordercolorrgba163 2171px 4px rgba0transitionopacity 05s easeopacity1b3datadisabledtrueborderwidth1px backgroundcolorrgba255 255topautobottom0textalignrightcolor000000ssg1buttons opacity10 05b1labelms249 249shqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbutton96 1shqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbutton06txtnewborder1px solid rgba51transitioncolor 04s ease980px 05000liststyletypesquarelineheightnormal body lrichtextcontainer40px importantsolid rgba0 0ifselectdataerrortruecolorfffffftransitioncolor 04s7px 2pxcolorffftextshadow1pxpagg1autoplayuldirrtl paddingright13emmarginright5emnormal 30px14em helveticaw01boldhelveticaw02boldhelveticaltw10boldsansserif255 255 1boxsizingborderbox05s 1mspositionfixed importantleftauto importantzindex50body lrichtextcontainerbodyvar1 0px255 255 1borderradius0borderrgba193 186 186boxsizingborderbox importantbackgroundcolorrgba255 255ssg1datastatetouchrolloverol ul liststyletypecirclelineheightnormalssg1autoplay span1borderradius0 boxshadow0255 255 16rgba108xixsutwetouchmediazoomiteminfolinear1boxsizingborderboxtainputtextarea11px14emnbspnmargin0positionrelativewidth100 importantheight100wati1input2pxcolorffftextshadow1px0 1oldirrtl paddingright13emmarginright5emwebkitkeyframespositionrelativewidth100height100wordwrapbreakwordcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock16px14em timesbackgroundcolor 04s2px rgba249textalignjustify important0px 0px 0positionrelativewhitespacenowrap16px14em1borderradius0 boxshadow0 0nmdash nmdashromantimesserif color000000wordbreakbreakworddisplayinlineblocklineheight1normalnmdashbody lrichtextcontainer ulshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel color000000ul liststyletypesquarelineheightnormal bodybackgroundcolorrgba160 8 38249 1backgroundcolorrgba255 255positionstaticboxshadow000 0 071bordersolid rgba0bodysrichtextcontainerbordersolidcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur05fontsize12pxfontweightbold04s easeitemborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolorapp1inlinecontent04s ease 0sborder 05sb3linkshqgiconleftimagebuttonwithtextbuttonextrainfo displaynone

Longtail Keyword Density for Smena98.ru

KeywordsOccurences
rgba0 0 066
04s ease 0s59
calc100 980px 0545
margin-left calc100 980px45
fontnormal normal normal25
0 0 022
background-colorrgba255 255 25521
times new romantimesserif20
3px rgba0 019
0 0 119
1px 3px rgba018
ease 0s background-color17
0s background-color 04s17
background-color 04s ease17
05s ease 0s17
13px14em times new15
normal 13px14em times15
normal normal 13px14em15
217 246 114
transitioncolor 04s ease13
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo color00000012
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel color00000012
positionstaticbox-shadow000 0 011
186 186 111
255 255 1border-radius011
font normal normal11
0 rgba0 011
255 255 1border-stylesolidborder-colorrgba16310
1border-stylesolidborder-colorrgba163 217 24610
n n n10
normal normal normal10
255 255 110
border-width1px background-colorrgba255 25510
255 1border-stylesolidborder-colorrgba163 21710
background-colorrgba160 8 389
1bordersolid rgba0 09
0 0 rgba09
box-shadow0 0 08
background-colorrgba204 204 2048
1background-colorrgba255 255 2558
0 0 068
background-colorrgba193 186 1868
transitionopacity 05s ease7
margin0line-heightnormalletter-spacingnormal heading srichtextcontainer7
margin0line-heightnormalletter-spacingnormal body lrichtextcontainer7
romantimesserif transitioncolor 04s7
1px 4px rgba07
new romantimesserif transitioncolor7
4px rgba0 07
fffborder-radius50box-shadow0 1px 3px6
8 38 1border-colorrgba06
solid fffborder-radius50box-shadow0 1px6
0px 0 0pxdisplayinline-blockpositionrelative6
background-colorrgba188 129 1416
255 1border-radius0 box-shadow06
importantbackground-colorrgba255 255 2556
borderrgba193 186 1866
186 1 solid6
1 solid 1px6
ul ul list-style-typesquareline-heightnormal6
ol ul list-style-typesquareline-heightnormal6
14px14em open sanssans-serif6
normal 14px14em open6
249 249 1background-colorrgba2556
box-shadow0 1px 4px6
249 1background-colorrgba255 2556
1 0pxcursorpointer important6
normal normal 14px14em6
1border-colorrgba0 0 05
1transitionborder-color 04s ease5
normal normal 11px14em5
38 1border-colorrgba0 05
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease5
1px 1px rgba05
normal 11px14em open5
11px14em open sanssans-serif5
1px rgba0 05
1border-radius0 box-shadow0 1px5
0px 0px 0positionrelativewhite-spacenowrap5
padding0 5pxdisplayinline importantfont-size14pxcolor0000005
li padding0 5pxdisplayinline5
204 204 1bordersolid5
0 0 05font-size12pxfont-weightbold5
laquo raquo n5
0 1 0pxcursorpointer5
204 1bordersolid rgba05
0 1 0px5
solid rgba0 05
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto5
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock5
2px rgba249 2494
0 borderrgba193 1864
ease 0s box-shadow04
0s box-shadow0 1px4
0 0 borderrgba1934
normal 30px14em helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-serif4
nbsp nbsp nbsp4
-7px -2pxcolorffftext-shadow1px 1px4
rgba249 249 2494
nn nn nn4
ease 0s color4
color 05s ease4
rgba108 97 964
0 -7px -2pxcolorffftext-shadow1px4
0s border 05s4
0s color 05s4
0px 0px 04
heightcalc100 40px important4
list-style-typesquareline-heightnormal heading srichtextcontainer4
ease 0s bordersolid4
importantmargin-bottom-11pxcolorfffbackgroundf00border2px solid fffborder-radius50box-shadow04
ul positionabsolutebottom10pxleft0right0text-aligncentercolor000000 important4
ul list-style-typesquareline-heightnormal body4
ul list-style-typesquareline-heightnormal heading4
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo displaynone4
colorfffffftransitioncolor 04s ease4
border-stylesolidborder-colorrgba249 249 2494
border-width2px border-stylesolidborder-colorrgba249 2494
ease 0s border4
255 1 ddm1navcontainer4
0 0 black4
open sanssans-serif color4436344
rgba255 255 2554
background-colorrgba0 0 04
ol ul ul4
ol ol ul4
05s 1ms linear4
1ms linear infinite4
normal normal 30px14em4
heading srichtextcontainer ol4
laquo raquo laquo4
ul list-style-typesquareline-heightnormal susaawrichtextclickableskinrichtextcontainer4
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel displaynone4
129 141 14
border 05s ease4
0 0 0154
-2pxcolorffftext-shadow1px 1px 3px4
normal normal 16px14em4
body lrichtextcontainer ul4
body lrichtextcontainer ol4
list-style-typesquareline-heightnormal body lrichtextcontainer4
raquo laquo raquo4
dotted rgba0 04
heading srichtextcontainer ul4
solid rgba108 974
1box-sizingborder-box importantborder-radius0 box-shadow03
box-sizingborder-box importantfontnormal normal3
importantfontnormal normal normal3
box-sizingborder-box importantoverflowhiddencursorpointer important3
box-sizingborder-box importantbackground-colorrgba255 2553
1border-radius0 box-shadow0 03
importantborder-radius0 box-shadow0 03
2018 nbspnbsp laquo3
laquoraquo laquoraquo laquoraquo3
new romantimesserif color0000003
0 0 border1px3
normal 16px14em times3
border1px solid rgba03
important body lrichtextcontainerbody3
54 52 13
ul ul ul3
ul ol ul3
ol ul list-style-typecircleline-heightnormal3
ul ul list-style-typecircleline-heightnormal3
solid rgba255 2553
0 0 053
width0 importantmin-width0 important3
important heading srichtextcontainerheading3
positionrelativewidth100 importantheight100 importantdisplayblock3
new romantimesserif color000000word-breakbreak-worddisplayinline-blockline-height13
color000000transitioncolor 04s ease3
positionfixed importantleftauto importantz-index503
solid rgba68 543
rgba68 54 523
positionabsolutetop0right0bottom0left0background-colorrgba255 255 2553
97 96 13
padding-right13emmargin-right5em body lrichtextcontainer3
padding-right13emmargin-right5em heading srichtextcontainer3
255 255 1box-sizingborder-box3
border-radius0 positionabsolutetop0right0bottom0left0background-colorrgba188 1293
16px14em times new3
normal normal 12px14em3
contentpositionabsolutebottom50left3pxmargin0 0 -7px3
contentpositionabsolutetext-aligncenterbottom50left-20pxwidth20pxheight20pxline-height20px importantmargin-bottom-11pxcolorfffbackgroundf00border2px solid3
normal 12px14em arial3
12px14em arial ms3
000000 0pxcursorpointer important3
positionabsolutetop0right0bottom0left0background-colorrgba188 129 1413
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-serif transitioncolor 04s3
arial ms pgothicdotumhelveticasans-serif3
30px14em helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-serif transitioncolor3
rgba51 51 513
solid rgba51 513
border1px solid rgba513
0 border1px solid3
box-shadow0 1px 1px3
positionabsolutetop0right0bottom0left0box-sizingborder-box importantbackground-colorrgba255 2553
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color 04s3
1970- mdash 1990-3
0 0133
ease 0s77
rgba0 066
04s ease63
normal normal52
255 25550
980px 0545
margin-left calc10045
calc100 980px45
laquo raquo32
fontnormal normal25
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel24
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo24
background-colorrgba255 25521
heading srichtextcontainer21
body lrichtextcontainer21
times new20
new romantimesserif20
0 119
3px rgba019
n n19
1px 3px18
186 18618
background-color 04s17
05s ease17
0s background-color17
ol ul15
13px14em times15
normal 13px14em15
246 114
ul ul14
217 24614
nbsp nbsp13
open sanssans-serif13
transitioncolor 04s13
shqgiconleftimagebuttonwithtextbuttonlabel color00000012
ul list-style-typesquareline-heightnormal12
204 20412
shqgiconleftimagebuttonwithtextbuttonextrainfo color00000012
129 14112
positionstaticbox-shadow000 011
0 rgba011
0pxcursorpointer important11
box-shadow0 1px11
font normal11
186 111
255 1border-radius011
255 1border-stylesolidborder-colorrgba16310
8 3810
quot quot10
255 110
border-width1px background-colorrgba25510
cursorpointer important10
spanbefore content10
1border-stylesolidborder-colorrgba163 21710
1bordersolid rgba010
box-shadow0 09
background-colorrgba160 89
54 529
0px 0px9
border1px solid9
background-colorrgba204 2048
1 solid8
227 2278
1background-colorrgba255 2558
background-colorrgba193 1868
nn nn8
0 068
249 2498
1border-radius0 box-shadow08
4px rgba07
romantimesserif transitioncolor7
margin0line-heightnormalletter-spacingnormal txtnew7
97 967
1px 4px7
transitionopacity 05s7
margin0line-heightnormalletter-spacingnormal heading7
margin0line-heightnormalletter-spacingnormal body7
margin0line-heightnormalletter-spacingnormal susaawrichtextclickableskinrichtextcontainer7
1ms linear6
importantbackground-colorrgba255 2556
normal 14px14em6
249 1background-colorrgba2556
fffborder-radius50box-shadow0 1px6
solid fffborder-radius50box-shadow06
solid 1px6
0 0pxdisplayinline-blockpositionrelative6
uldirrtl padding-right13emmargin-right5em6
38 1border-colorrgba06
1 0pxcursorpointer6
0px 06
ul list-style-typecircleline-heightnormal6
14px14em open6
background-colorrgba188 1296
borderrgba193 1866
1px 1px6
1px rgba05
0 05font-size12pxfont-weightbold5
lrichtextcontainer ul5
0 -7px5
1transitionborder-color 04s5
raquo n5
normal 11px14em5
positionabsolutetop0right0bottom0left0transitionborder-color 04s5
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur5
solid rgba05
0px 0positionrelativewhite-spacenowrap5
srichtextcontainer ul5
1border-colorrgba0 05
204 1bordersolid5
colore4523f important5
1 0px5
padding0 5pxdisplayinline5
li padding05
tblc1 tbody5
5pxdisplayinline importantfont-size14pxcolor0000005
ul positionabsolutebottom10pxleft0right0text-aligncentercolor0000005
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto5
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock5
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur5
1 ddm1navcontainer5
11px14em open5
shqgiconleftimagebuttonwithtextbuttonicon left04
srichtextcontainer ol4
list-style-typesquareline-heightnormal heading4
0 borderrgba1934
shqgiconleftimagebuttonwithtextbuttonlabel displaynone4
0s box-shadow04
1box-sizingborder-box importantborder-radius04
shqgiconleftimagebuttonwithtextbuttonicon right04
span white-spacenormal4
0 0154
141 14
0 black4
shqgiconleftimagebuttonwithtextbuttonicon -webkit-animation-nameshqgiconleftimagebuttonwithtextheartbeatanimation-nameshqgiconleftimagebuttonwithtextheartbeat-webkit-animation-duration05sanimation-duration05s4
color 05s4
0s bordersolid4
mdash n4
mdash nn4
border 05s4
0s border4
heightcalc100 40px4
40px important4
raquo laquo4
laquoraquo laquoraquo4
-2pxcolorffftext-shadow1px 1px4
0s color4
-7px -2pxcolorffftext-shadow1px4
positionabsolutebottom10pxleft0right0text-aligncentercolor000000 important4
importantmargin-bottom-11pxcolorfffbackgroundf00border2px solid4
rgba249 2494
2px rgba2494
nn mdash4
shqgiconleftimagebuttonwithtextbuttonextrainfo displaynone4
susaawrichtextclickableskinrichtextcontainer ul4
solid rgba1084
text-alignright important4
h1 margin0line-heightnormalletter-spacingnormal4
p margin0line-heightnormalletter-spacingnormal4
ol ol4
rgba108 974
ol list-style-typedecimal4
ul list-style-typedisc4
txtnew ul4
li font-styleinheritfont-weightinheritline-heightinheritletter-spacingnormal4
text-alignjustify important4
text-aligncenter important4
text-alignleft important4
h3 margin0line-heightnormalletter-spacingnormal4
background-colorrgba0 04
rgba255 2554
color ffffff4
background-color ffffff4
border-width2px border-stylesolidborder-colorrgba2494
important heading4
border-stylesolidborder-colorrgba249 2494
colorfffffftransitioncolor 04s4
dotted rgba04
opacity1 ssg1data-statetouchrollover4
ssg1buttons opacity14
h2 margin0line-heightnormalletter-spacingnormal4
ul ol4
h4 margin0line-heightnormalletter-spacingnormal4
susaawrichtextclickableskinrichtextcontainer ol4
body lrichtextcontainerbody4
sanssans-serif color4436344
h5 margin0line-heightnormalletter-spacingnormal4
lrichtextcontainer ol4
normal 30px14em4
30px14em helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-serif4
list-style-typesquareline-heightnormal susaawrichtextclickableskinrichtextcontainer4
important body4
list-style-typesquareline-heightnormal body4
normal 16px14em4
heading srichtextcontainerheading4
linear infinite4
05s 1ms4
h6 margin0line-heightnormalletter-spacingnormal4
importantleftauto importantz-index503
positionfixed importantleftauto3
1970- mdash3
color000000transitioncolor 04s3
solid rgba683
romantimesserif color000000word-breakbreak-worddisplayinline-blockline-height13
selectdata-previewerror ddm1navcontainerarrow3
rgba68 543
ddm1navcontainerarrow ddm1navcontainersvgcontainer3
positionabsolutetop0right0bottom0left0background-colorrgba255 2553
nbspnlaquo raquo3
arial ms3
52 13
laquo ndash3
ms pgothicdotumhelveticasans-serif3
2018 nbspnbsp3
n- n-3
raquo mdash3
nbspnn laquo3
1200 20003
nbspnbsp laquo3
nn laquo3
romantimesserif color0000003
12px14em arial3
nmdash nmdash3
normal 12px14em3
16px14em times3
padding-right13emmargin-right5em heading3
width0 importantmin-width03
96 13
oldirrtl padding-right13emmargin-right5em3
contentpositionabsolutetext-aligncenterbottom50left-20pxwidth20pxheight20pxline-height20px importantmargin-bottom-11pxcolorfffbackgroundf00border2px3
000000 0pxcursorpointer3
ul padding-left13emmargin-left5emline-heightnormalletter-spacingnormal3
padding-right13emmargin-right5em susaawrichtextclickableskinrichtextcontainer3
positionabsolutetop0right0bottom0left0background-colorrgba188 1293
border-radius0 positionabsolutetop0right0bottom0left0background-colorrgba1883
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-serif transitioncolor3
ultxtnew ol3
51 513
rgba51 513
solid rgba513
0 border1px3
padding-right13emmargin-right5em body3
positionabsolutetop0right0bottom0left0box-sizingborder-box importantbackground-colorrgba2553
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color3
contentpositionabsolutebottom50left3pxmargin0 03
255 1box-sizingborder-box3
importantborder-radius0 box-shadow03
ssg1imageitempanel opacity03
10px 10px3
ssg1autoplay span3
opacity1 ssg1hover3
ssg1pnl opacity13
box-sizingborder-box importantbackground-colorrgba2553
importantoverflowhiddencursorpointer important3
box-sizingborder-box importantoverflowhiddencursorpointer3
positionrelativewidth100 importantheight1003
box-sizingborder-box importantfontnormal3
importantheight100 importantdisplayblock3
importantmin-width0 important3
min-width10px important3
1 pggcg0gallerydisplayerhover3
0 053
solid rgba2553
importantfontnormal normal3
mdash 1990-3
0268
1100
normal96
282
ease81
0s78
important77
rgba067
04s63
solid59
n58
ul54
background-color53
shqgiconleftimagebuttonwithtextbuttontextwrapper52
laquo48
0548
1px46
raquo45
980px45
calc10045
margin-left45
nn42
displaynone40
color40
mdash40
color00000039
336
nbsp36
0px30
margin0line-heightnormalletter-spacingnormal28
fontnormal25
new25
ol25
body25
heading25
srichtextcontainer24
lrichtextcontainer24
424
shqgiconleftimagebuttonwithtextbuttonextrainfo24
shqgiconleftimagebuttonwithtextbuttonlabel24
times22
quot22
susaawrichtextclickableskinrichtextcontainer21
05s21
background-colorrgba25521
3px21
box-shadow020
romantimesserif20
opacity119
1border-radius019
txtnew18
cursorpointer17
positionabsolutetop0right0bottom0left017
516
shqgiconleftimagebuttonwithtextbuttonicon16
border-radius016
616
716
13px14em15
nbspnn15
814
914
1014
1114
open13
content13
transitioncolor13
laquoraquo13
sanssans-serif13
ddm1navcontainer13
span13
list-style-typesquareline-heightnormal12
1212
width10012
1bordersolid11
0pxcursorpointer11
border-width1px11
positionstaticbox-shadow00011
box-sizingborder-box11
ddm1navcontainerarrow11
font11
1310
ndash10
1border-stylesolidborder-colorrgba16310
p10
transitionopacity10
spanbefore10
1410
li9
justify-contentflex-start9
justify-contentflex-end9
border1px9
159
padding-right13emmargin-right5em9
text-aligninitialdisplayflexalign-itemscenter9
background-colorrgba1609
tblc19
justify-contentcenter9
ffffff9
10px9
b3link8
b3labelwrapper8
068
wati1input8
padding08
1background-colorrgba2558
background-colorrgba2048
0000008
b3label8
2px8
-8
168
uldirrtl8
nbspn8
background-colorrgba1938
4px7
1990-7
177
color4436347
bordersolid7
187
colore4523f7
1box-sizingborder-box7
var7
197
207
fffborder-radius50box-shadow06
oldirrtl6
216
importantbackground-colorrgba2556
text-alignleft6
text-aligncenter6
226
background-colorffffff6
1970-6
236
borderrgba1936
tainputtextarea6
0pxdisplayinline-blockpositionrelative6
right06
nmdash6
n-6
left06
246
background-colorrgba1886
list-style-typecircleline-heightnormal6
1ms6
linear6
select6
14px14em6
1border-colorrgba06
ddm1navcontainerarrowddm1navcontainercenter-direction6
ddm1navcontainerarrowddm1navcontainerright-direction6
ssg1imageitempanel6
ddm1navcontainerarrowddm1navcontainerleft-direction6
opacity06
margin06
1transitionborder-color5
255
quotquot5
-7px5
pggcg1itemscontainer5
05font-size12pxfont-weightbold5
265
importantfont-size14pxcolor0000005
watai1data-stateinvalid5
0positionrelativewhite-spacenowrap5
positionabsolutetop0right0bottom0left0transitionborder-color5
5pxdisplayinline5
positionabsolutebottom10pxleft0right0text-aligncentercolor0000005
275
arial5
pggcg0gallerydisplayerhover5
285
40px5
app1data-stateloading5
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur5
ssg1buttons5
295
ssg1autoplay5
305
3-5
if5
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng5
pggcg4itemscontainer5
ultxtnew5
auto5
border-radius5px5
autooverflowhiddendisplayblock5
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur5
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng5
315
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-serif5
015s5
nbspnbsp5
border05
importantheight1005
11px14em5
tbody5
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton4
324
sutwetouchmediazoomiteminfo4
lb1itemscontainer4
style-k72d8mcglabelwrapper4
border4
selectdata-previewhover4
white-spacenormal4
item4
b0b0b04
black4
pafter4
0154
334
344
watai14
-2pxcolorffftext-shadow1px4
pggcg3itemscontainer4
importantborder-radius04
dotted4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton4
blog4
-webkit-animation-nameshqgiconleftimagebuttonwithtextheartbeatanimation-nameshqgiconleftimagebuttonwithtextheartbeat-webkit-animation-duration05sanimation-duration05s4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton4
border-left1px4
ddm1repeaterbuttonlabel4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton4
pggcg0gallerydisplayer4
heightcalc1004
snkvktouchmediazoomimageinfo4
border-stylesolidborder-colorrgba2494
border-width2px4
border-radiusinherit4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton4
importantoverflowhiddencursorpointer4
354
td4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton4
rgba2494
importantmargin-bottom-11pxcolorfffbackgroundf00border2px4
364
b3data-disabledfalseactivedata-statemobile4
30px14em4
infinite4
b3data-disabledtrue4
app1inlinecontent4
h64
h54
h44
h34
h24
h14
style-k72d98t6labelwrapper4
colorfffffftransitioncolor4
ssg1data-statetouchrollover4
positionrelativewidth1004
list-style-typedecimal4
list-style-typedisc4
font-styleinheritfont-weightinheritline-heightinheritletter-spacingnormal4
text-alignjustify4
text-alignright4
displayblock4
overflowhidden4
background-colorrgba04
wp1rollover4
vl1line4
rgba2554
b3data-stateshoulduseflex4
transparent4
lrichtextcontainerbody4
16px14em4
rgba1084
year4
374
ecomco1labelwrapper4
ecomatc1label4
ecomrfc1labelwrapper4
ssg1helpers4
ecomvc1label4
ecomvc1link4
ecomatc1link4
ecomvc1labelwrapper4
ecomrfc1link4
b1labelwrapper4
xix4
positionrelative4
srichtextcontainerheading4
selectdata-previewfocus4
b1link4
b1label4
wacb14
ecomatc1labelwrapper4
selecthover3
383
ms3
paginationnext-webkit-user-selectnonedisplayinline-block-ms-user-selectnone-webkit-touch-calloutnonepadding03
393
shy3
403
20-3
413
nbspnlaquo3
photographer3
ddm1navcontainerleft-direction3
423
ddm1navcontainersvgcontainer3
12px14em3
433
0003
443
453
pgothicdotumhelveticasans-serif3
photo3
463
nbsp-3
selectfocus3
ddm1repeaterbuttondata-statedrop3
selectdata-errortrue3
ssg1pnl3
left10pxright10px3
contentpositionabsolutebottom50left3pxmargin03
contentpositionabsolutetext-aligncenterbottom50left-20pxwidth20pxheight20pxline-height20px3
hc2bg3
positionabsolutetop0right0bottom0left0background-colorrgba2553
positionabsolutetop0right0bottom0left0background-colorrgba1883
ecomco1link3
ssg1btn3
rgba513
positionabsolutetop0right0bottom0left0box-sizingborder-box3
ssg1hover3
iframe3
style-k72d5ntybg3
padding-left13emmargin-left5emline-heightnormalletter-spacingnormal3
colorffffff3
positionrelativewidth100height100word-wrapbreak-word3
keyframes3
-webkit-keyframes3
app1loading3
style-k72d98t6label3
importantdisplayblock3
width03
importantmin-width03
min-width10px3
margin-left-05pxwidth1003
rgba683
textareafocus3
style-k72d8mcglabel3
ddm1navcontainercenter-direction3
sutwetouchmediazoomitemimagecontainer3
snkvktouchmediazoomimageimagecontainer3
snkvktouchmediazoomcentereddiv3
selectdata-previewerror3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton3
ddm1navcontainerright-direction3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton3
topautobottom03
shqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton3
pggcg2itemscontainer3
color000000word-breakbreak-worddisplayinline-blockline-height13
pagg1autoplay3
color000000transitioncolor3
ecometi1erase3
ecometi1input3
ecomti1data-stateinvalid3
importantfontnormal3
positionfixed3
importantleftauto3
importantz-index503
473

Who hosts Smena98.ru?

Smena98.ru Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Pepyaka/1.19.0

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Smena98.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 28 Nov 2020 14:06:25 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1606572385.16519059257115631
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhP3UVzDz9CrWcUvFvX3Kki,2d58ifebGbosy5xc FRaloPX4ngKfQM8fEHbwELHijmPXAlbMpvSp5OOQ3Z/Q0elH2yWikl2EP5bJKtoyukhjw==,Nlv1KFVtIvAfa3AK9dRsIw0RGekeQjUjEjaqOdzQTL bpeoPBxy7lii6zmufEAr0,2UNV7KOq4oGjA5 PKsX47PacouZIurdHKYy 3qobDts=,qquldgcFrj2n046g4RNSVPD6c5erGeYLdtSDjMSpcyU=,u3CNwl6zAd2E01MQck4H7BqMWvvg12oQulXXHEunhRRNG KuK VIZfbNzHJu0vJu,kO0u 7q TL0DeeE//9W7MD6evkJYQwaiwboBzqad/KRMZY15GBRR u26iTypuJDfWIHlCalF7YnfvOr2cMPpyw==,u3CNwl6zAd2E01MQck4H7BqMWvvg12oQulXXHEunhRRNG KuK VIZfbNzHJu0vJu,l7Ey5khejq81S7sxGe5Nk8 5S 0/0FlHiQHD 2obu6pXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHG5NMqkRr3yc7qxvw lx8WdklHMTftnSO329exkYhhr2UXmGlpkZJat/3 9F222TSI=,l7Ey5khejq81S7sxGe5Nk8 5S 0/0FlHiQHD 2obu6pXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,l7Ey5khejq81S7sxGe5Nk1ZZIMkU5HdUwS8RIYAFzfaTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LlHHrtdZwfqSTe7u8ayFI0G3ybJlEMQoDW11NrJgY4T/lrOxuqrjbp5y9 GFnzW JWohFFiMwIEr5SBCICuGxA==,l7Ey5khejq81S7sxGe5Nk8 5S 0/0FlHiQHD 2obu6pXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,Ts 7R/4FijtA6c9psi3FQFXZmtTppa3RPSe8meVrJHtNG KuK VIZfbNzHJu0vJu,CU5GbgCT5nWPaA3tUS4mLGIKXacaXu6vTDycYV TU dzSeD2cBoGJnyFJPDjrwrQHaAg2tAYOHNCFq H4W6GtA==
cache-control: private,max-age=0,must-revalidate
Server: Pepyaka/1.19.0
Content-Encoding: gzip

Smena98.ru Domain Nameserver Information

HostIP AddressCountry
ns1.wix.com 185.230.61.165
ns2.wix.com 185.230.60.165


Need to find out who hosts Smena98.ru?


Domain Registration (WhoIs) information for Smena98.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: SMENA98.RU
nserver: ns1.wix.com.
nserver: ns2.wix.com.
state: REGISTERED, DELEGATED, UNVERIFIED
person: Private Person
registrar: REGRU-RU
admin-contact: http://www.reg.ru/whois/admin_contact
created: 2014-10-03T10:06:52Z
paid-till: 2021-10-03T11:06:52Z
free-date: 2021-11-03
source: TCI

Last updated on 2020-11-28T14:01:32Z

Websites with Similar Names

Smena-31.ru
Сайт газеты "Смена"
Smena-anapa.ru
СКО СМЕНА Анапа Сукко
Smena-auto.ru
Смена-Авто - Главная
Smena-direktora.ru
????? ???????????? ?????????. ????? ????????? ??? ?? 1500 ???. ????????? ???????????? ?????????
Smena-fitness.ru
Смена - фитнес клуб рядом с метро Сокол, Войковская, Панфиловская, Красный Октябрь и Аэропорт в СВАО Москвы
Smena-online.ru
Смена
Smena-torg.ru
Website Suspended
Smena.fun
SMENA.FUN

Recently Updated Websites

Strongleadershipedge.us (1 second ago.)Alamaglobal.com (3 seconds ago.)Vabsart.xyz (4 seconds ago.)Elliottdonovan.us (5 seconds ago.)Sumtrain.us (6 seconds ago.)Elementflooring.us (10 seconds ago.)Advance4k.com (11 seconds ago.)Shopcacrew.us (11 seconds ago.)Alenaandjen.com (12 seconds ago.)Aditenindustries.com (13 seconds ago.)Bikersofamerica.us (13 seconds ago.)6ixappliances.com (14 seconds ago.)Alibrotherbank.com (15 seconds ago.)Airsidecommunity.com (15 seconds ago.)Alexadrunk.com (15 seconds ago.)17thletter.com (16 seconds ago.)Allviralnews.com (18 seconds ago.)Abinawaihsaninct.com (19 seconds ago.)Keepmonth.us (22 seconds ago.)Afrilliastore.com (23 seconds ago.)Mixedmessage.us (24 seconds ago.)Alicetilche.com (29 seconds ago.)Acrylicmanagement.com (30 seconds ago.)Aetnasbetterhealth.com (33 seconds ago.)Abrempong.com (33 seconds ago.)Afronized.com (35 seconds ago.)Acrylicshieldguards.com (35 seconds ago.)6iganet.com (38 seconds ago.)6-pr.com (40 seconds ago.)6-no.com (40 seconds ago.)

Recently Searched Keywords

vn chm (1 second ago.)t vn chm (1 second ago.)itemtitle (6 seconds ago.)ideal (8 seconds ago.)köp (8 seconds ago.)arabic (27 seconds ago.)veggie bagel fillings (36 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (39 seconds ago.)chauffeur service (42 seconds ago.)018 46517com 018 (46 seconds ago.)og (47 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (50 seconds ago.)sex videos (51 seconds ago.)khan dhaka-1230 orientation (51 seconds ago.)best horror movies (1 minute 15 seconds ago.)o hacia (1 minute 17 seconds ago.)dat we (1 minute 18 seconds ago.)fotografia nieruchomoĺ›ci (1 minute 28 seconds ago.)isolation (1 minute 38 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (1 minute 49 seconds ago.)stream tv (1 minute 50 seconds ago.)not something (1 minute 59 seconds ago.)tck istanbul (2 minutes ago.)018 018 (2 minutes 3 seconds ago.)laquoil (2 minutes 4 seconds ago.)tričká - krátky rukáv (2 minutes 5 seconds ago.)ingelheim ltd (2 minutes 5 seconds ago.)mekanik tesisat taahht (2 minutes 6 seconds ago.)taahht ve (2 minutes 7 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (2 minutes 8 seconds ago.)