Sngcsa.org Favicon Sngcsa.org

Sngcsa.org Website Thumbnail
Checking...
Golf Course Superintendent Association | SNGCSA | Nevada
Low trust score
Add a review Change category Claim this site
The SNGCSA provides for and enhance the recognition of the golf course superintendent as a professional in Southern Nevada, and to collect and disseminate information on a statewide basis to assist our members in providing for better maintenance and construction of our golf courses.


Domain summary

Domain label
sngcsa
Domain extension
org
Domain registered:
2005-11-14
Domain updated:
2020-10-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is sngcsa.org ranked relative to other sites:

Percentage of visits to sngcsa.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sngcsa.org registered?
A: Sngcsa.org was registered 14 years, 11 months, 1 week, 3 days, 9 hours, 4 minutes, 19 seconds ago on Monday, November 14, 2005.
Q: When was the WHOIS for Sngcsa.org last updated?
A: The WHOIS entry was last updated 2 days, 9 hours, 4 minutes, 19 seconds ago on Thursday, October 22, 2020.
Q: What are Sngcsa.org's nameservers?
A: DNS for Sngcsa.org is provided by the following nameservers:
  • ns14.wixdns.net
  • ns15.wixdns.net
Q: Who is the registrar for the Sngcsa.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Sngcsa.org?
A: Sngcsa.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Sngcsa.org each day?
A: Sngcsa.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Sngcsa.org resolve to?
A: Sngcsa.org resolves to the IPv4 address 23.236.62.147.
Q: In what country are Sngcsa.org servers located in?
A: Sngcsa.org has servers located in the United States.
Q: What webserver software does Sngcsa.org use?
A: Sngcsa.org is powered by webserver.
Q: Who hosts Sngcsa.org?
A: Sngcsa.org is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Sngcsa.org worth?
A: Sngcsa.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Sngcsa.org?

Sngcsa.org Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Sngcsa.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 22 Oct 2020 09:27:17 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.sngcsa.org/
content-language: en
X-Wix-Request-Id: 1603358837.70554118071167911772
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: jeslxIFvDH4ulYwNNi 3Muwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVivd4o9HMoDTVPhK7/s60Jl,2d58ifebGbosy5xc FRalpWKzS1IPSwVzk9cQOhHCSKGugrvhGIoO1v8FzzrXcC4tV73G91ZFzW WU71Md5jhw==,2UNV7KOq4oGjA5 PKsX47EAqIWNBw7tMwm1Esy VM5Y=,m0j2EEknGIVUW/liY8BLLox3LFhlpbffVUFbLzszg6o=,qQbTLsvPZVUXp9HeAm/lzOkfzpKlzgLy JaBlSybkKJGp/J3MBzgzU8QHrQuh4zQ,nxVDKlf5lZ8xGkFSmm2J1i7t rkSFZUL 6bYr hVhDvX/axWgJLXbwqkkIpP VLIu/5w0MIeAp8KSIu115FwsQ==
Cache-Control: no-cache
Expires: -1

Sngcsa.org Domain Nameserver Information

HostIP AddressCountry
ns14.wixdns.net 216.239.32.100
ns15.wixdns.net 216.239.34.100


Need to find out who hosts Sngcsa.org?


WhoIs information for Sngcsa.org

 Domain Name: SNGCSA.ORG
Registry Domain ID: D108520557-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-11-15T15:52:15Z
Creation Date: 2005-11-14T14:55:30Z
Registry Expiry Date: 2020-11-14T14:55:30Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Southern Nevada Golf Course Superintendents Association
Registrant State/Province: Nevada
Registrant Country: US
Name Server: NS14.WIXDNS.NET
Name Server: NS15.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-22T05:59:28Z

Sngcsa.org Free SEO Report

Website Inpage Analysis for Sngcsa.org

H1 Headings

0 :

H2 Headings

1 :
  1. WE  LOVE  OUR SPONSORS

H3 Headings

2 :
  1. BECOME A 
  2. MEMBER

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

4 :
  1. UPCOMING
  2. EVENTS
  3. SPONSORSHIP OPPORTUNITIES
  4. Contact Us

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

14:
  1. #mask-comp-jrs9lfofimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.sngcsa.org
  2. 0
    https://www.sngcsa.org/cart-page
  3. About
    https://www.sngcsa.org/about
  4. Upcoming Events
    https://www.sngcsa.org/events
  5. Membership
    https://www.sngcsa.org/membership
  6. News
    https://www.sngcsa.org/blog
  7. Sponsors
    https://www.sngcsa.org/sponsors
  8. Resources
    https://www.sngcsa.org/resources
  9. Contact Us
    https://www.sngcsa.org/contact-us
  10. Privacy Statement
    https://www.sngcsa.org/privacy
  11. LEARN MORE
    https://www.sngcsa.org/events
  12. Become a Sponsor
    https://www.sngcsa.org/become-a-sponsor
  13. Apply Online
    https://www.sngcsa.org/membership-1
  14. Back to Top
    https://www.sngcsa.org

Links - Internal (nofollow)

0:

Links - Outbound

10:
  1. No text
    https://twitter.com/sincitygcsa
  2. No text
    https://www.facebook.com/Southern-Nevada-Golf-Course-Superintendents-Association-371953309553839/
  3. Covid-19 Information
    https://www.gcsaa.org/resources/covid-19-pandemic-resources
  4. No text
    https://www.ewingirrigation.com/
  5. No text
    http://www.wcsg.com/
  6. No text
    http://www.simplot.com/turf_horticulture/simplot_partners
  7. No text
    http://www.simpsonnorton.com/
  8. No text
    http://www.turftime.net/hello-world-2/
  9. No text
    http://www.turftechinc.net/
  10. No text
    https://www.harrells.com/

Links - Outbound (nofollow)

0:

Keyword Cloud for Sngcsa.org

stylejskm3pa2datastatefieldmessagehidden1inscfontsize60pxn nninfosvgtypeshapeviewbox0normal 14px14eminfoelementdescriptioncompjsyulonkfullscreensocialbackgroundcolorrgba204 204galleryitemcontainern nninfosvgtypeshapeviewbox0 0superintendent association sngcsaultxtnew204 importantcompjsyulonk progalleryinlinestylesbuttoncompjsyulonk progalleryinlinestyles galleryitemcontainerprogallerymobileindicatornninfosvgtypeshapeviewbox0galleryitemdescriptioncompjsyulonk progalleryinlinestyles galleryitemcontainerinfoelementtitlecompjsyulonk progalleryinlinestylesralewaysansseriftextdecorationgalleryitemdescriptioncompjsyulonk progalleryinlinestyles galleryitemcontainerprogallerymobileindicator0 0normal normal 16px14eminotprogallerylovednotinfoelementlovedcompjsyulonk1bordercolortransparentgalleryitemcontainer galleryitemwrapper galleryslideshowinfobackgroundcolor ffffffpayment method1backgroundcolorrgba255 255 255stylejsl2ahcrnavcontainerarrowstylejsl2ahcrnavcontainerleftdirection1inscfontsize80px importantrgba204 204normal normal normalhelveticaw01lighthelveticaw02lightsansseriftextdecoration compjsyulonk progalleryinlinestylesborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolorgolf coursesmetakeywordsseopagetitleseogolf courseprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrappercalc100basisinfoelementtitleitemfontslideshow normal normalhelveticaw01lighthelveticaw02lightsansseriftextdecoration compjsyulonk0s backgroundcolor 04stransparentstylejsl2ahcrnavcontainerleftdirectionpositionfixedpoppinssemiboldpoppinssansserifitemfontcolorslideshowprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfonormal normal 14px14em8colorease 0scolorccccccfontnormal9319px255 1 stylejsl2ahcrnavcontainerol ulsuperintendentlulocleanw01oneboldsansserif transitioncolor 04s06 importantcompjsyulonkfontnormal normal normalimportantfontnormal normalhelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationn n06 importantcompjsyulonk progalleryinlinestylesdisplaynone15px14em ralewaysansserifgalleryitemhoverbeforeitemopacitycolorffffffselecthoverclickralewaysansserifitemdescriptionfontcolorslideshowstylejrtisgeclabelwrapperbuttoncompjsyulonk progalleryinlinestylesstylek8t3c96dlabelwrapper153 06 importantcompjsyulonkassociationfontsize14pxtxtnew ulstoreborderstylesolidbordercolorrgba249 249selectdatapreviewerror stylejsl2ahcrnavcontainerarrowfill04s easeborderstylesolidbordercolorrgba249 249 249importantfontnormalcollectgalleryitemcontainer galleryslideshowinforgba0 92 560 200fullscreenmobilebar16px14emstylejskm3pa2datastatemobileauto10px14emcompjsyulonk profullscreenwrappersvghelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjsyulonk249 1backgroundcolorrgba255 255profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarolprofessional in southerncompjsyulonk profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesnormal normal 22px27px0sfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennav0s backgroundcolorgalleryitemtitlecompjsyulonk progalleryinlinestyles galleryitemcontainerprogallerymobileindicatornevadawithcontactimportantfontnormal normal normalcustombuttonwrapper buttoncompjsyulonk153 06golf2pxcursorpointerpoppinssemiboldpoppinssansserif34 importantcompjsyulonkprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialstylejrtih4tj2labelwrapperulstylejsc5xsombg13galleryslideshowinfo svggalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhovernormal normal 10px14eminfoelementtitlecompjsyulonk04scalc100 980px 05our golf56 1color ffffff204 1galleryslideshowinfo infoelementtitleitemfontslideshow04s ease 0stopautobottom0normal normalprofullscreenwrappercf1datastaterightgalleryslideshowinfo galleryitemtitlecompjsyulonk progalleryinlinestyles340pxgalleryitemwrapper galleryitemhovercoursesmetakeywordsseopagetitleseogolftransitioncolor 04s easeonlineassociation sngcsa15px14em ralewaysansserifcolorrgb204n n nninfosvgtypeshapeviewbox0galleryitemhoverbeforeitemopacity ccccccbackgroundrgba153 153marginleft calc100 340pxb0b0b0positionabsolutetop0right0bottom0left0marginleft calc100 319pxbold 60px14em1inscfontsize75pxconstructioninfoelementcustombuttonwrappercalc100 340px340px 05poppinssemiboldpoppinssansserif colorffffffgalleryitemtitlecompjsyulonk222222colorrgb34 3422px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjsyulonk2progalleryinlinestyles galleryitemcontainer galleryitembottominfomargin0solid rgba102222222colorrgb34 34 34compjsyulonk92 56 1backgroundcolorralewaysansserifitemdescriptionfontcolorslideshow cccccccolorrgb204980px 05fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialstylek8t3c96dlinkmargin0lineheightnormalletterspacingnormalboldsolid rgba102 102easecompjsyulonk progalleryinlinestyles galleryitemcontainercccccccolorrgb204 204 204stylejsl2ahcrnavcontainerarrowstylejsl2ahcrnavcontainercenterdirectiongalleryitemhover22px27pxborderwidth2px borderstylesolidbordercolorrgba249stylejrsd3ks4labelwrapperyourprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylespositionfixed importantleftauto importantzindex5027px14em204 204progalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfoup your paymentneuenormal normal 27px14emralewaysansseriftextdecoration compjsyulonknormal 15px18px helveticaw01lighthelveticaw02lightsansseriftextdecoration15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationstylejrtisgeclabeldivccccccbackgroundrgba153transitioncolor 04s34compjsyulonk progalleryinlinestylesbackgroundcolorrgba123 11512marginleftnevadabackgroundcolortransparentbordersolidstylejskm97r6labelwrapper1bordersolidinfoelementtitleitemfontslideshow normalgalleryitemwrapper galleryslideshowinfo svgvisitors15px14em ralewaysansseriftextdecorationimportantn n nlulocleanw01oneboldsansserifpositionstaticboxshadow000 0galleryitemcontainerprogallerymobileindicator galleryslideshowinfocoursesmetakeywordsseopagetitleseogolf course superintendentborderwidth2px borderstylesolidbordercolorrgba249 249profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavpoppinssemiboldpoppinssansserifitemfontcolorslideshow cccccccolorrgb204 20434 34compjsyulonk profullscreenwrapperultxtnew olobjectcf1datastatemobiledisseminate informationselectdatapreviewfocusinotprogallerylovedcompjsyulonkease 0s backgroundcolor204 204fontnormal34 34compjsyulonk progalleryinlinestylesccccccbackgroundrgba153 153color8b0000 stylejskm3pa2poppinssemiboldpoppinssansserifitemfontcolorslideshow cccccccolorrgb204stylek8t3c96dlabeltextareaplaceholderassociation sngcsa nevadapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidw41b3ivgq9w1cbgmetadatapageidw41b3ispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidw41b3desktopmediarefmetadatapageidw41b3ispresetfalseschemaversion10ishiddenfalsetitlebackgroundgalleryslideshowinfo galleryitemdescriptioncompjsyulonk31inscfontsize60px important204fontnormal normalcourse6galleryitemwrapper204 importantfontnormalpoppinssemiboldpoppinssansseriftextdecoration compjsyulonkbuttonnotprogallerylovednotinfoelementlovedcompjsyulonk progalleryinlinestylescollect and disseminatecourse superintendentselectdatapreviewerror10px14em lulocleanw01oneboldsansserif transitioncolorselectfocusfullscreensidebarsocialstylejsl2ahcrnavcontainersvgcontainerbuttoncompjsyulonk204compjsyulonk profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesjustifycontentflexstart204 204 importantcompjsyulonkcustombuttonwrappergolf course superintendentbuttonselectdataerrortruenormal 22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationnevadawith wordfullgalleryslideshowinfo galleryitemdescriptioncompjsyulonk progalleryinlinestylesfont normal normalpositionabsolutetop0right0bottom0left0transitionbordercolor 04s easegolf coursesmetakeywordsseopagetitleseogolfstylejrsd3ks4label204 1bordersolid rgba204cccccccolorrgb204galleryitemcontainer galleryitemwrapper2px 2px 0positionrelativewhitespacenowrap204 204 importantfontnormallicf1rightimportantleftautoprogalleryinlinestyles galleryitemcontainer galleryitemwrapperstylejsl2ahcrrepeaterbuttonlabelcolor8b0000cccccccolorrgb204 204normal 15px14em ralewaysansseriftextdecorationccccccbackgroundrgba153 153 153transitioncolorprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfostatewide1 stylejsl2ahcrnavcontainer34 34 importantcompjsyulonknormal 10px14em lulocleanw01oneboldsansserifnormal normal 15px18px249 1backgroundcolorrgba255204 204 1bordersolidbuttoncompjsyulonk progalleryinlinestyles galleryitemcontainercalc100 319pxhelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjsyulonk progalleryinlinestylesproviding for betterbackgroundcolorrgba204 204 204115 111fontnormalcompjsyulonk progalleryinlinestyles92 56positionstaticboxshadow000 0 0our memberspositionfixed importantleftautotextareawebkitinputplaceholdergalleryitemcontainerprogallerymobileindicator galleryitemtopinfoourstylejsl2ahcrnavcontainerarrowstylejsl2ahcrnavcontainerrightdirection22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration1bordersolid rgba204your payment1 2pxcursorpointer importantgalleryitemhoverdefaultforcehoverbeforecompjsyulonk4normal normal 15px14emimportantzindex50normalnormal 15px14em ralewaysansserifstylejskm97r6link60px14emcf1datastateleftstrc1dataresponsivejustifycontentcentergalleryslideshowinfo infoelementtitleitemfontslideshow normalgalleryslideshowinfogetenhance the recognitionassistrgba102 102 102width100galleryitemtextcourse superintendent associationcalc100 319px 05backgroundcolor 04s ease111 1bordercolortransparentcoursesmetakeywordsseopagetitleseogolf courseprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialenhance2px 0positionrelativewhitespacenowrapnormal 22px27px34 34compjsyulonkstylejrtih4tj2labelborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolor 04sinput3tstqgalleryitemhoverdefaultnothidehoverbeforebackgroundccccccbackgroundcolorrgba123infoelementcustombuttonwrapper buttoncompjsyulonk progalleryinlinestylesnninfosvgtypeshapeviewbox0 0 200progalleryinlinestyles galleryitemcontainer galleryitemtopinforgba102204 204fontnormal normalnormal 15px18pxrgba204 204 204font normalhelveticanormal 15px14em ralewaysansserifcolorrgb204normal 16px14emhelveticaw01lighthelveticaw02lightsansseriftextdecorationyouralewaysansserifitemdescriptionfontcolorslideshow cccccccolorrgb204 204galleryitemdescriptioncompjsyulonkgalleryslideshowinfo galleryitemtitlecompjsyulonkfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialnormal 10px14em153 153 06ralewaysansserifcolorrgb204 204galleryitemhoverdefaultforcehoverbeforecompjsyulonk progalleryinlinestyles34 3415px14emimportantcompjsyulonk progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorpoppinssemiboldpoppinssansseriftextdecorationtextaligninitialdisplayflexalignitemscenter1 2pxcursorpointerborderwidth2pxwordfull319px 05margin0lineheightnormalletterspacingnormal txtnewralewaysansserif cf1newborderradius0assist ouryour payment methodgalleryitembottominfonevadapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidw41b3ivgq9w1cbgmetadatapageidw41b3ispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidw41b3desktopmediarefmetadatapageidw41b3ispresetfalseschemaversion10ishiddenfalsetitlebackgroundnormal 27px14emfontnormal normal153 153255 255 1fullscreennav1bordersolid rgba204 204members in providingstylejskm97r6labelconstruction of ourstylejskm3pa2stylejrtih4tj2linkacompjsyulonk profullscreenwrappervarinotprogallerylovedcompjsyulonk profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles1 2pxacompjsyulonk profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles15px14em ralewaysansserifitemdescriptionfontcolorslideshowbetter maintenancejustifycontentflexend34compjsyulonk profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylespositionabsolutetop0right0bottom0left0transitionbordercolorgalleryitemhoverdefaultnothidehoverbeforebackgroundcccccc importantcompjsyulonk progalleryinlinestyles222222colorrgb34payment15px18pxrgba204204 204 1normal 15px14em ralewaysansserifitemdescriptionfontcolorslideshowinfoelementtitleitemfontslideshowgalleryitemhoverbeforeitemopacity ccccccbackgroundrgba153stylejsl2ahcrnavcontainerrgba0 92galleryitemcontainerprogallerymobileindicator galleryitemwrapperinotprogallerylovedcompjsyulonk profullscreenwrapper980pxprofessionalgalleryitemhover svgnormal bolddivprogalleryparentcontainercf1informationstatewide basis204 204compjsyulonk204 importantfontnormal normal34compjsyulonk249 249rgba0galleryitemcontainer galleryitembottominfocompjsyulonk progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorpositionstaticboxshadow000fullscreenviewfullscreenbrightprofullscreeninlinestylesprovidesinfoelementcustombuttonwrapper buttoncompjsyulonkcompjsyulonkgalleryitemcontainerprogallerymobileindicator7204 1bordersolidmethoddisseminate15px14em ralewaysansserifitemdescriptionfontcolorslideshow cccccccolorrgb204buttoncompjsyulonk profullscreenwrapper2pxmaintenancegalleryitemgalleryitemvideo249 249 1backgroundcolorrgba255inotprogallerylovednotinfoelementlovedcompjsyulonk progalleryinlinestyles2pxcursorpointer importantrgba102 102galleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfosngcsa255 25506cccccccolorccccccsuperintendent associationtextarealulocleanw01oneboldsansserif transitioncolor204fontnormalprogalleryinlinestyles15px14em ralewaysansserif cf1acompjsyulonkgalleryitemhoverdefaultnothidehoverbeforebackgroundcccccc importantcompjsyulonk14px14emgalleryitemdescriptioncompjsyulonk progalleryinlinestyles15px14em ralewaysansserifcolorrgb204 204normal bold 60px14emprogalleryinlinestyles galleryitemcontainer1inscfontsize75px important1backgroundcolorrgba255stylejsl2ahcrnavcontainerarrowstylejsl2ahcrnavcontainerrightdirectionsngcsa provides204compjsyulonkffffffstylejrtisgeclinkpositionabsolutetop0right0bottom0left0transitionbordercolor 04ssolidassist our memberstxtnewprovidinggalleryitemwrapper galleryitemhover svggolf course11galleryitemcontainer galleryitemwrapper galleryitemhoverselectdatapreviewhoverimportantcompjsyulonk progalleryinlinestylesbackgroundcolor 04sbackgroundcolorrgba204102 102calc100 980pxgalleryitemcontainerprogallerymobileindicator galleryitembottominfocalc100 340px 05stylejsl2ahcrnavcontainercenterdirectionn204 204compjsyulonk profullscreenwrappermarginleft calc10010px14em lulocleanw01oneboldsansserifbasis to assistprogalleryinlinestyles galleryitemcontainer galleryslideshowinfogalleryitemtitlecompjsyulonk progalleryinlinestyles2px 2px34 importantcompjsyulonk progalleryinlinestylesfontsize14px stylejskm3pa2datastatemobileartgalleryitemwrapper galleryitemgalleryitemvideomembers5pxbuttonnotprogallerylovednotinfoelementlovedcompjsyulonkralewaysansserifbuttoncompjsyulonk profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemwrapper galleryslideshowinfostylejrsd3ks4link204 1 2pxnninfosvgtypeshapeviewbox0 0maintenance and constructionbackgroundcolorrgba123 115 1111inscfontsize80px204 importantcompjsyulonkbetterour golf coursesmetakeywordsseopagetitleseogolf1backgroundcolorrgba255 255up yourgalleryitemcontainer galleryitemtopinfogalleryitemtopinfoif15px18px helveticaw01lighthelveticaw02lightsansseriftextdecoration compjsyulonkmarginleft calc100 980px204compjsyulonk profullscreenwrappergalleryitemtitlecompjsyulonk progalleryinlinestyles galleryitemcontainer15px14em ralewaysansseriftextdecoration compjsyulonklb1itemscontainer5115 111 1bordercolortransparentstylejsl2ahcrnavcontainerarrow stylejsl2ahcrnavcontainersvgcontainerimportantcompjsyulonk progalleryinlinestyles galleryitemcontainersouthernfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatorsngcsa nevadapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidw41b3ivgq9w1cbgmetadatapageidw41b3ispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidw41b3desktopmediarefmetadatapageidw41b3ispresetfalseschemaversion10ishiddenfalsetitlebackgroundstrc1inlinecontentralewaysansserifcolorrgb204upnormal 15px14emborderstylesolidbordercolorrgba24910span0positionrelativewhitespacenowrapli1importantleftauto importantzindex50importantcompjsyulonkinfoelementdescriptioncompjsyulonk progalleryinlinestyles034compjsyulonk profullscreenwrapperfontrecognitionsouthern nevada050 0 0custombuttonwrapper buttoncompjsyulonk progalleryinlinestylesoldirrtl255 1

Longtail Keyword Density for Sngcsa.org

KeywordsOccurences
normal normal 15px14em41
normal normal normal32
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
n n n21
margin-left calc100 980px20
calc100 980px 0520
04s ease 0s17
importantfontnormal normal normal15
gallery-item-container gallery-item-wrapper gallery-item-hover14
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
normal 15px14em ralewaysans-serif12
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
custom-button-wrapper buttoncomp-jsyulonk pro-galleryinline-styles10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
normal 15px14em ralewaysans-seriftext-decoration10
normal normal 27px14em10
font normal normal10
normal normal 15px18px9
204 importantfontnormal normal9
204 204 importantfontnormal9
importantcomp-jsyulonk pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
fontnormal normal normal9
153 153 068
buttoncomp-jsyulonk pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
buttoncomp-jsyulonk pro-galleryinline-styles gallery-item-container8
cccccccolorrgb204 204 2047
comp-jsyulonk pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
normal 15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jsyulonk7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jsyulonk pro-galleryinline-styles7
importantcomp-jsyulonk pro-galleryinline-styles gallery-item-container7
comp-jsyulonk pro-galleryinline-styles gallery-item-container7
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
255 255 16
info-element-custom-button-wrapper buttoncomp-jsyulonk pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
06 importantcomp-jsyulonk pro-galleryinline-styles6
153 06 importantcomp-jsyulonk6
204 204 16
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
rgba204 204 2046
ease 0s background-color5
n nninfosvgtypeshapeviewbox0 05
204 1 2px5
1 2pxcursorpointer important5
superintendent association sngcsa5
n n nninfosvgtypeshapeviewbox05
normal normal 14px14em5
2px 2px 0positionrelativewhite-spacenowrap5
gallery-item-titlecomp-jsyulonk pro-galleryinline-styles gallery-item-container5
115 111 1border-colortransparent5
transitioncolor 04s ease5
lulo-clean-w01-one-boldsans-serif transitioncolor 04s5
normal normal 22px27px5
enhance the recognition5
golf course superintendent5
gallery-item-descriptioncomp-jsyulonk pro-galleryinline-styles gallery-item-container5
background-colorrgba123 115 1115
course superintendent association5
background-colorrgba204 204 2045
collect and disseminate5
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease5
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color 04s5
1bordersolid rgba204 2045
professional in southern5
gallery-item-descriptioncomp-jsyulonk pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-titlecomp-jsyulonk pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
204 1bordersolid rgba2045
204 204 1bordersolid5
0s background-color 04s5
basis to assist5
assist our members5
background-color 04s ease5
members in providing5
providing for better5
maintenance and construction5
construction of our5
normal 15px14em ralewaysans-serifcolorrgb2044
inotpro-gallery-lovedcomp-jsyulonk pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
15px14em ralewaysans-seriftext-decoration comp-jsyulonk4
acomp-jsyulonk pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundcccccc importantcomp-jsyulonk pro-galleryinline-styles4
ccccccbackgroundrgba153 153 1534
15px14em ralewaysans-serifcolorrgb204 2044
204 204 importantcomp-jsyulonk4
34 importantcomp-jsyulonk pro-galleryinline-styles4
normal 10px14em lulo-clean-w01-one-boldsans-serif4
255 1 style-jsl2ahcrnavcontainer4
10px14em lulo-clean-w01-one-boldsans-serif transitioncolor4
1background-colorrgba255 255 2554
249 1background-colorrgba255 2554
34 34 importantcomp-jsyulonk4
249 249 1background-colorrgba2554
border-stylesolidborder-colorrgba249 249 2494
border-width2px border-stylesolidborder-colorrgba249 2494
rgba102 102 1024
15px14em ralewaysans-serif cf14
solid rgba102 1024
92 56 14
normal normal 10px14em4
gallery-slideshow-info gallery-item-titlecomp-jsyulonk pro-galleryinline-styles4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
gallery-slideshow-info gallery-item-descriptioncomp-jsyulonk pro-galleryinline-styles4
gallery-item-wrapper gallery-slideshow-info svg4
gallery-item-wrapper gallery-item-hover svg4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jsyulonk pro-galleryinline-styles4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jsyulonk4
204 importantcomp-jsyulonk pro-galleryinline-styles4
normal 22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
poppins-semiboldpoppinssans-serif--itemfontcolorslideshow cccccccolorrgb204 2044
info-element-title--itemfontslideshow normal normal4
up your payment3
nninfosvgtypeshapeviewbox0 0 2003
positionstaticbox-shadow000 0 03
normal bold 60px14em3
our golf coursesmetakeywordsseopagetitleseogolf3
golf coursesmetakeywordsseopagetitleseogolf course3
coursesmetakeywordsseopagetitleseogolf course superintendent3
normal normal 16px14em3
positionfixed importantleftauto importantz-index503
association sngcsa nevadapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidw41b3ivgq9w1cbgmetadatapageidw41b3ispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidw41b3desktopmediarefmetadatapageidw41b3ispresetfalseschemaversion10ishiddenfalsetitlebackground3
204comp-jsyulonk pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
margin-left calc100 319px3
gallery-item-hoverbefore--itemopacity ccccccbackgroundrgba153 1533
222222colorrgb34 34 34comp-jsyulonk3
ralewaysans-serif--itemdescriptionfontcolorslideshow cccccccolorrgb204 2043
15px14em ralewaysans-serif--itemdescriptionfontcolorslideshow cccccccolorrgb2043
normal 15px14em ralewaysans-serif--itemdescriptionfontcolorslideshow3
34 34comp-jsyulonk pro-galleryinline-styles3
calc100 340px 053
margin-left calc100 340px3
calc100 319px 053
0 0 03
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
34 34comp-jsyulonk pro-fullscreen-wrapper3
34comp-jsyulonk pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
204 204fontnormal normal3
comp-jsyulonk pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
204 204comp-jsyulonk pro-fullscreen-wrapper3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
rgba0 92 563
buttoncomp-jsyulonk pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
your payment method3
normal normal116
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator49
pro-galleryinline-styles gallery-item-container49
normal 15px14em41
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-container gallery-item-wrapper29
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
204 20428
gallery-item-wrapper gallery-item-hover28
n n28
margin-left calc10026
importantcomp-jsyulonk pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
980px 0520
calc100 980px20
04s ease18
0 017
ease 0s17
buttoncomp-jsyulonk pro-galleryinline-styles16
importantfontnormal normal15
comp-jsyulonk pro-galleryinline-styles14
15px14em ralewaysans-serif12
153 15310
255 25510
course superintendent10
normal 27px14em10
custom-button-wrapper buttoncomp-jsyulonk10
15px14em ralewaysans-seriftext-decoration10
font normal10
gallery-item-descriptioncomp-jsyulonk pro-galleryinline-styles10
gallery-item-titlecomp-jsyulonk pro-galleryinline-styles10
204 importantfontnormal9
normal 15px18px9
fontnormal normal9
cccccccolorrgb204 2049
153 068
222222colorrgb34 347
34 34comp-jsyulonk7
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
34 347
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jsyulonk7
margin0line-heightnormalletter-spacingnormal txtnew7
255 16
1inscfont-size60px important6
204 16
06 importantcomp-jsyulonk6
gallery-item-container gallery-item-bottom-info6
gallery-item-container gallery-item-top-info6
gallery-item-container gallery-slideshow-info6
info-element-custom-button-wrapper buttoncomp-jsyulonk6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
rgba204 2046
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
0s background-color5
normal 14px14em5
positionabsolutetop0right0bottom0left0transitionborder-color 04s5
golf course5
southern nevada5
disseminate information5
statewide basis5
assist our5
our members5
better maintenance5
our golf5
superintendent association5
association sngcsa5
n nninfosvgtypeshapeviewbox05
nninfosvgtypeshapeviewbox0 05
0 2005
sngcsa provides5
normal 22px27px5
transitioncolor 04s5
111 1border-colortransparent5
2pxcursorpointer important5
1 2pxcursorpointer5
lulo-clean-w01-one-boldsans-serif transitioncolor5
2px 0positionrelativewhite-spacenowrap5
2px 2px5
background-colorrgba123 1155
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color5
1 2px5
1bordersolid rgba2045
204 1bordersolid5
background-color 04s5
1 style-jsl2ahcrnavcontainer5
background-colorrgba204 2045
115 1115
gallery-slideshow-info gallery-item-descriptioncomp-jsyulonk4
34 importantcomp-jsyulonk4
ccccccbackgroundrgba153 1534
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jsyulonk4
gallery-item-hoverdefaultforce-hoverbeforecomp-jsyulonk pro-galleryinline-styles4
info-element-titlecomp-jsyulonk pro-galleryinline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundcccccc importantcomp-jsyulonk4
normal bold4
color8b0000 style-jskm3pa24
info-element-descriptioncomp-jsyulonk pro-galleryinline-styles4
inotpro-gallery-lovedcomp-jsyulonk pro-fullscreen-wrapper4
15px14em ralewaysans-serifcolorrgb2044
ralewaysans-serifcolorrgb204 2044
ralewaysans-serif cf14
ralewaysans-seriftext-decoration comp-jsyulonk4
nevadawith wordfull4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
1inscfont-size80px important4
poppins-semiboldpoppinssans-serif--itemfontcolorslideshow cccccccolorrgb2044
gallery-slideshow-info svg4
normal 10px14em4
10px14em lulo-clean-w01-one-boldsans-serif4
1background-colorrgba255 2554
249 1background-colorrgba2554
249 2494
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
gallery-item-wrapper gallery-itemgallery-item-video4
info-element-title--itemfontslideshow normal4
102 1024
rgba102 1024
txtnew ul4
solid rgba1024
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jsyulonk pro-galleryinline-styles4
gallery-slideshow-info info-element-title--itemfontslideshow4
gallery-item-hover svg4
204 importantcomp-jsyulonk4
gallery-slideshow-info gallery-item-titlecomp-jsyulonk4
inotpro-gallery-lovednotinfo-element-lovedcomp-jsyulonk pro-galleryinline-styles4
92 564
56 14
acomp-jsyulonk pro-fullscreen-wrapper4
normal 16px14em3
rgba0 923
sngcsa nevadapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidw41b3ivgq9w1cbgmetadatapageidw41b3ispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidw41b3desktopmediarefmetadatapageidw41b3ispresetfalseschemaversion10ishiddenfalsetitlebackground3
golf coursesmetakeywordsseopagetitleseogolf3
coursesmetakeywordsseopagetitleseogolf course3
up your3
your payment3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
buttoncomp-jsyulonk pro-fullscreen-wrapper3
calc100 319px3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
background-color ffffff3
calc100 340px3
340px 053
34comp-jsyulonk pro-galleryinline-styles3
15px14em ralewaysans-serif--itemdescriptionfontcolorslideshow3
ralewaysans-serif--itemdescriptionfontcolorslideshow cccccccolorrgb2043
positionstaticbox-shadow000 03
1inscfont-size75px important3
ol ul3
ultxtnew ol3
importantleftauto importantz-index503
positionfixed importantleftauto3
poppins-semiboldpoppinssans-seriftext-decoration comp-jsyulonk3
color ffffff3
204comp-jsyulonk pro-fullscreen-wrapper3
gallery-item-hoverbefore--itemopacity ccccccbackgroundrgba1533
style-jsl2ahcrnavcontainerarrow style-jsl2ahcrnavcontainersvgcontainer3
selectdata-previewerror style-jsl2ahcrnavcontainerarrow3
319px 053
font-size14px style-jskm3pa2data-statemobile3
poppins-semiboldpoppinssans-serif colorffffff3
34comp-jsyulonk pro-fullscreen-wrapper3
bold 60px14em3
204 204fontnormal3
204fontnormal normal3
comp-jsyulonk pro-fullscreen-wrapper3
204 204comp-jsyulonk3
payment method3
normal202
pro-galleryinline-styles111
065
gallery-item-wrapper58
gallery-item-container50
gallery-item-containerpro-gallery-mobile-indicator49
149
background-color41
15px14em41
important37
color36
n35
pro-fullscreen-wrapper32
gallery-slideshow-info32
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
226
margin-left26
0526
calc10026
323
importantcomp-jsyulonk22
421
your21
comp-jsyulonk20
980px20
520
buttoncomp-jsyulonk19
ease18
positionabsolutetop0right0bottom0left018
04s18
txtnew18
0s17
2px16
svg16
ralewaysans-serif15
importantfontnormal15
cf114
style-jsl2ahcrnavcontainer13
gallery-item-top-info12
style-jskm3pa212
gallery-item-bottom-info12
style-jsl2ahcrnavcontainerarrow11
ul11
colorffffff11
font11
sngcsa11
fontnormal10
ralewaysans-seriftext-decoration10
27px14em10
gallery-item-titlecomp-jsyulonk10
course10
golf10
superintendent10
info-element-custom-button-wrapper10
our10
610
custom-button-wrapper10
gallery-item-descriptioncomp-jsyulonk10
cccccccolorrgb2049
textarea9
15px18px9
3tstq9
78
margin08
color8b00008
068
var7
margin0line-heightnormalletter-spacingnormal7
222222colorrgb347
ol7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
34comp-jsyulonk7
rgba2046
poppins-semiboldpoppinssans-serif6
ffffff6
solid6
cf1data-statemobile6
style-jsl2ahcrnavcontainerarrowstyle-jsl2ahcrnavcontainercenter-direction6
style-jsl2ahcrnavcontainerarrowstyle-jsl2ahcrnavcontainerright-direction6
border-radius06
width1006
1inscfont-size60px6
information6
helvetica6
style-jsl2ahcrnavcontainerarrowstyle-jsl2ahcrnavcontainerleft-direction6
professional5
southern5
if5
provides5
nevada5
collect5
divpro-gallery-parent-container5
22px27px5
style-jskm3pa2data-statemobile5
disseminate5
statewide5
recognition5
enhance5
background-colorrgba2045
1bordersolid5
transitioncolor5
justify-contentcenter5
justify-contentflex-start5
justify-contentflex-end5
nninfosvgtypeshapeviewbox05
positionabsolutetop0right0bottom0left0transitionborder-color5
members5
payment5
providing5
better5
maintenance5
lulo-clean-w01-one-boldsans-serif5
construction5
auto5
0positionrelativewhite-spacenowrap5
background-colortransparentbordersolid5
basis5
2pxcursorpointer5
background-colorrgba1235
85
95
1border-colortransparent5
14px14em5
li5
association5
text-aligninitialdisplayflexalign-itemscenter5
displaynone5
ultxtnew5
105
assist5
114
rgba1024
124
gallery-itemgallery-item-video4
inotpro-gallery-lovednotinfo-element-lovedcomp-jsyulonk4
nevadawith4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jsyulonk4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundcccccc4
store4
bold4
gallery-item-text4
ralewaysans-serifcolorrgb2044
info-element-descriptioncomp-jsyulonk4
info-element-titlecomp-jsyulonk4
gallery-item-hoverdefaultforce-hoverbeforecomp-jsyulonk4
info-element-title--itemfontslideshow4
ccccccbackgroundrgba1534
134
b0b0b04
cccccccolorcccccc4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
up4
poppins-semiboldpoppinssans-serif--itemfontcolorslideshow4
lb1itemscontainer4
online4
border-width2px4
style-jrsd3ks4link4
style-jrtisgeclink4
style-jrtisgeclabel4
style-jrtih4tj2labelwrapper4
style-jrtih4tj2link4
style-jrtih4tj2label4
neue4
acomp-jsyulonk4
textarea-webkit-input-placeholder4
textareaplaceholder4
10px14em4
style-jrsd3ks4label4
style-k8t3c96dlabelwrapper4
style-k8t3c96dlink4
border-stylesolidborder-colorrgba2494
style-k8t3c96dlabel4
style-jskm97r6labelwrapper4
fill4
wordfull4
1background-colorrgba2554
style-jrtisgeclabelwrapper4
5px4
1inscfont-size80px4
inotpro-gallery-lovedcomp-jsyulonk4
style-jsl2ahcrrepeaterbuttonlabel4
style-jrsd3ks4labelwrapper4
style-jskm97r6label4
style-jskm97r6link4
contact3
you3
visitors3
art3
method3
get3
nevadapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidw41b3ivgq9w1cbgmetadatapageidw41b3ispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidw41b3desktopmediarefmetadatapageidw41b3ispresetfalseschemaversion10ishiddenfalsetitlebackground3
click3
fullscreen-social3
fullscreen-mobile-bar3
fullscreen-nav3
coursesmetakeywordsseopagetitleseogolf3
input3
fullscreen-side-bar-social3
strc1data-responsive3
selectdata-previewfocus3
selectfocus3
selectdata-previewhover3
selecthover3
style-jsl2ahcrnavcontainerleft-direction3
style-jsl2ahcrnavcontainersvgcontainer3
positionstaticbox-shadow0003
oldirrtl3
strc1inlinecontent3
selectdata-previewerror3
style-jsc5xsombg3
topautobottom03
importantz-index503
importantleftauto3
positionfixed3
60px14em3
16px14em3
new3
selectdata-errortrue3
style-jsl2ahcrnavcontainerright-direction3
204comp-jsyulonk3
font-size14px3
204fontnormal3
gallery-item-hoverbefore--itemopacity3
poppins-semiboldpoppinssans-seriftext-decoration3
ralewaysans-serif--itemdescriptionfontcolorslideshow3
340px3
319px3
1inscfont-size75px3
style-jskm3pa2data-statefieldmessagehidden3
transparent3
style-jsl2ahcrnavcontainercenter-direction3
cf1data-stateleft3
cf1data-stateright3
licf1right3
button3
colorccccccfontnormal3
span3
rgba03
div3
object3

Sngcsa.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Sngcsa.org is a scam?

Websites with Similar Names

Sngcs.org
Sree Narayana Guru Central School, Ezhukone, Kollam, Kerala
Sngcsa.org
Golf Course Superintendent Association | SNGCSA | Nevada

Recently Updated Websites

Tellalinstitute.com 1 second ago.Tacticaljunkee.com 1 second ago.Skinnyops.com 1 second ago.Yudivest.com 1 second ago.Westerndigs.org 2 seconds ago.Kmapes.org 3 seconds ago.Saintspeterpaulpalmyra.org 3 seconds ago.Mapsdirectionsto.com 3 seconds ago.Trithin.com 3 seconds ago.Radioflavours.org 4 seconds ago.Palmscripts.com 4 seconds ago.Exocortex.systems 5 seconds ago.Doctorleech.com 5 seconds ago.Gtsalud.com 5 seconds ago.Hhmarry.com 5 seconds ago.Puh.lv 5 seconds ago.Activelifefamilychiro.com 6 seconds ago.Feuerwehrsanitaeter.org 6 seconds ago.Theblogismine.com 6 seconds ago.Cp3-origins.dk 6 seconds ago.A-i-d.org 6 seconds ago.Dafontfree.com 7 seconds ago.Whymix.com 7 seconds ago.Edvardtoth.com 7 seconds ago.Maquinasdecoserdioni.com 7 seconds ago.Chandansteel.net 7 seconds ago.Realhomescolorado.com 8 seconds ago.Teachersfuckteens.com 8 seconds ago.Putnam-psychiatry.com 8 seconds ago.Studentloanshow.com 9 seconds ago.