Sodimac.cl | Todo en Hogar y Construcción

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 18,799
Estimated Worth: $979,200

En Sodimac.cl, encuentra todo lo necesario para tus proyectos de hogar: Muebles, Decoración, Herramientas, Ferretería, Construcción, Baño, Cocina y mucho más



Domain summary

Last updated
2020-10-14
Domain label
sodimac
Domain extension
cl
Global Traffic Rank
18,799
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$979,200
Estimated daily income
$1,360
Estimated monthly income
$41,367

Rank summary

How is sodimac.cl ranked relative to other sites:

Percentage of visits to sodimac.cl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sodimac.cl registered?
A: Sodimac.cl was registered 5 months, 4 weeks, 10 hours, 46 minutes, 55 seconds ago on Wednesday, October 14, 2020.
Q: When was the WHOIS for Sodimac.cl last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 10 hours, 46 minutes, 55 seconds ago on Wednesday, October 14, 2020.
Q: What are Sodimac.cl's nameservers?
A: DNS for Sodimac.cl is provided by the following nameservers:
  • zeus.ns.cloudflare.com
  • zeus.ns.cloudflare.com
  • rafe.ns.cloudflare.com
  • rafe.ns.cloudflare.com
Q: Who is the registrar for the Sodimac.cl domain?
A: The domain has been registered at NIC Chile.
Q: What is the traffic rank for Sodimac.cl?
A: Sodimac.cl ranks 18,799 globally on Alexa. Sodimac.cl has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Sodimac.cl each day?
A: Sodimac.cl receives approximately 113,293 visitors and 679,758 page impressions per day.
Q: What IP address does Sodimac.cl resolve to?
A: Sodimac.cl resolves to the IPv4 address 104.16.38.43.
Q: In what country are Sodimac.cl servers located in?
A: Sodimac.cl has servers located in the United States.
Q: What webserver software does Sodimac.cl use?
A: Sodimac.cl is powered by CloudFlare webserver.
Q: Who hosts Sodimac.cl?
A: Sodimac.cl is hosted by CloudFlare, Inc. in United States.
Q: How much is Sodimac.cl worth?
A: Sodimac.cl has an estimated worth of $979,200. An average daily income of approximately $1,360, which is roughly $41,367 per month.

Sodimac.cl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sodimac.cl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sodimac.cl

H1 Headings

1 :
  1. En Sodimac, juntos construimos sueños de hogar

H2 Headings

27 :
  1. Toldos y Pérgolas
  2. Calefont y Termos
  3. Cerámicas de Exterior
  4. Racks y Soportes de TV
  5. Espejos
  6. Televisores LED
  7. Lavandería
  8. Porcelanatos
  9. OSB
  10. WC - Sanitarios
  11. Policarbonato y Fibra de Vidrio
  12. Racks y Soportes de TV
  13. Espejos
  14. Televisores LED
  15. Lavandería
  16. Porcelanatos
  17. OSB
  18. WC - Sanitarios
  19. Policarbonato y Fibra de Vidrio
  20. Racks y Soportes de TV
  21. Espejos
  22. Televisores LED
  23. Lavandería
  24. Porcelanatos
  25. OSB
  26. WC - Sanitarios
  27. Policarbonato y Fibra de Vidrio

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

640:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sodimac.cl

y lucespiedras ycargadoresy movilidadalfombras vinlicos yantigolpeslubricantes yinfantillinklandingcat400014seguridadinfantilishighlightlinkfalselabelseguridad baoy baos0 0riegopapelpersianas yperimetrallinklandingcat4850499seguridadhogaroficinayperimetralishighlightlinkfalselabelcontrol de accesoconstructorlinklandingscat913783maquinariasyherramientasconstructorleafcategorieslabelbetonerasportablesferreteraprgolas quinchosarroceraslinkcategoryscat115138freidorasyarrocerasishighlightlinkfalselabelsacajugos ybaos paramotriceslinkcategorycat1060016sondasvibradorasyunidadesmotricesishighlightlinkfalselabelplacas compactadoraslinkcategorycat1060014placascompactadorasishighlightlinkfalselabelcarretillas yy ropacamas elsticas ycentro lateralesfijacionesy hornosretrocesoelctricas yasaderaslinkcategorycat4850048fuentesyasaderasishighlightlinkfalselabelcuchillos ycomercialespicotas yropa paraseguridadlinklandingcat4850148controldeaccesoyseguridadishighlightlinkfalselabelseguridad infantillinklandingcat400014seguridadinfantilishighlightlinkfalselabelseguridadcopaslinkcategorycat2960011vasosycopasishighlightlinkfalselabeldispensadores de vidrioy equipamientococinalinkcategorycat260028utensiliosdecocinaishighlightlinkfalselabeltermos ysusproyectosy purificadoresfuerteslinkcategoryscat874882cajasfuertesishighlightlinkfalselabelseguridadsillasautoslinkcategoryscat934755seguridadparaautosishighlightlinkfalselabelcajascopaslinkcategorycat2960011vasosycopasishighlightlinkfalselabeldispensadoresventanaspisos flotanteshacersoporteehervidoreslinkcategorycat9100003cafeteraselectricasyhervidoresishighlightlinkfalselabelsandwicheras y parrillasterraza y1 autolo necesario paramesa ynivelesrascadoresrelacionadaselctricaslinkcategorycat8720054sandwicherasyparrillaselectricasishighlightlinkfalselabelfreidorasparrillasvlvulas de aguay limpiadoreslinkcategorycat4850177detergentesylimpiadoresishighlightlinkfalselabelutensiliosbao yledlavanderaporcelanatososbwc sanitariospolicarbonato ydesbrozadoraslinkcategorycat4930001orilladorasydesbrozadorasishighlightlinkfalselabelcortasetos yentretenidalinkcategorycat1060021cocinaentretenidaishighlightlinkfalselabelprocesadoras ytubospersianas cortinasfuerteslinkcategoryscat874882cajasfuertesishighlightlinkfalselabelseguridad viallinkcategoryscat348855seguridadvialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenasexterior y focoscontenedoresy hardboardy herramientas constructorlinklandingscat913783maquinariasyherramientasconstructorleafcategorieslabelbetonerasy bolsaslinkcategorycat220008basureroscontenedoresybolsasishighlightlinkfalselabeldetergentes yy rielesgomainfantillinkcategoryscat915263menajeinfantilishighlightlinkfalselabelmenajeacceso yy hervidoreslinkcategorycat9100003cafeteraselectricasyhervidoresishighlightlinkfalselabelsandwicheras yasaderaslinkcategorycat4850048fuentesyasaderasishighlightlinkfalselabelcuchillos y tablaslinkcategorycat11370003cuchillosytablasishighlightlinkfalselabelutensilioscollares yviallinkcategoryscat348855seguridadvialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas cuerdasy exprimidoreslinkcategoryscat115133sacajugosyexprimidoresishighlightlinkfalselabelcocinayobao cocinay wokslinkcategoryscat317797sartenesywoksishighlightlinkfalselabelfuentesal cliente 600hogar oficina yy utensilios paraspa eeslingas ycaimanes yferretera construccin baogarantay lubricantes paracctellinkcategorycat1020008barycoctelishighlightlinkfalselabelcaf y tlinkcategorycat4850085cafeyteishighlightlinkfalselabeltextilexterior paracasetaseasemedia prefersreducedmotioncerraduras alarmas yfuerteslinkcategoryscat874882cajasfuertesishighlightlinkfalselabelseguridad viallinkcategoryscat348855seguridadvialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas cuerdasdemoledoreslinkcategorycat1080069rotomartillosydemoledoresishighlightlinkfalselabelsondas vibradoras ylateraleslibrellanas yy asientosinfantiles yy botellaslinkcategorycat11370001termosybotellasishighlightlinkfalselabelconservadorescentrocompactadoraslinkcategorycat1060014placascompactadorasishighlightlinkfalselabelcarretillas y ruedaslinkcategoryscat913779carretillasyruedasishighlightlinkfalselabelteclesiluminacinprgolas quinchos yy vajillaslinkcategorycat4850316juegosdelozayvajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasosreducidalinkcategoryscat922150seguridadbanoymovilidadreducidaishighlightlinkfalselabelseguridad para autoslinkcategoryscat934755seguridadparaautosishighlightlinkfalselabelcajascompactadoraslinkcategorycat1060014placascompactadorasishighlightlinkfalselabelcarretillassemillas yacero ycomplementospor mallatvespejostelevisorespara autosmesalinkcategorycat920058textilmesaishighlightlinkfalselabelmenaje infantillinkcategoryscat915263menajeinfantilishighlightlinkfalselabelmenajeparrillas elctricaslinkcategorycat8720054sandwicherasyparrillaselectricasishighlightlinkfalselabelfreidoras5aseolinkcategoryscat963517utensiliosdeaseoishighlightlinkfalselabelpapeles y dispensadoreslinkcategorycat4850182papelesydispensadoresishighlightlinkfalselabelaseoprgolasquecermica ymuebles ypor unproteccin personal linklandingscat913754elementosdeproteccionpersonalishighlightlinkfalselabelseguridadbordadosemillas600 40reparacinmedicin ytelefnica 600 600los productosbao cocina yruedaslinkcategoryscat913779carretillasyruedasishighlightlinkfalselabeltecles y huincheslinkcategorycat710296teclesyhuinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadorasdispensadoreslinkcategorycat4850182papelesydispensadoresishighlightlinkfalselabelaseovideotuempresassobremantencin yy tostadoreslinkcategorycat8720053microondashornosytostadoresishighlightlinkfalselabelcafeterassoportesmallas yeslingasestatodo lo necesarioy hervidoreslinkcategorycat9100003cafeteraselectricasyhervidoresishighlightlinkfalselabelsandwicherastoldosdee2e6y comederos paracocinalinklandingcat10890001menajecocinaleafcategorieslabelbateras de cocinabolsaslinkcategorycat220008basureroscontenedoresybolsasishighlightlinkfalselabeldetergentespulidocermicatextilequiposeasemediaperimetrallinklandingcat4850499seguridadhogaroficinayperimetralishighlightlinkfalselabelcontrolbaos y arenaautoslinkcategoryscat934755seguridadparaautosishighlightlinkfalselabelcajas fuerteslinkcategoryscat874882cajasfuertesishighlightlinkfalselabelseguridad viallinkcategoryscat348855seguridadvialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenasantenasneumticos yy aspiradoy complementosy copaslinkcategorycat2960011vasosycopasishighlightlinkfalselabeldispensadoreshuincheslinkcategorycat710296teclesyhuinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadoras de pavimentolinkcategorycat4850151cortadorasdepavimentoishighlightlinkfalselabelpalassin4remy bancospartidoresloza yexteriory fundas paraalarmas ybolsaslinkcategorycat220008basureroscontenedoresybolsasishighlightlinkfalselabeldetergentes ycomodesbrozadoraslinkcategorycat4930001orilladorasydesbrozadorasishighlightlinkfalselabelcortasetosherramientas constructorlinklandingscat913783maquinariasyherramientasconstructorleafcategorieslabelbetonerasruedas antenas yy seguridadlinklandingcat4850148controldeaccesoyseguridadishighlightlinkfalselabelseguridadalfombras vinlicoshumedadymamparaspouflinkcategoryscat292444banquetasypoufishighlightlinkfalselabelpoltronas y sitialeslinkcategorycat1130138poltronasysitialesishighlightlinkfalselabelmueblescocina ycasas paray tromposlinkcategoryscat100035betonerasytromposishighlightlinkfalselabelrotomartillos ylimpiadoreslinkcategorycat4850177detergentesylimpiadoresishighlightlinkfalselabelutensilios de aseolinkcategoryscat963517utensiliosdeaseoishighlightlinkfalselabelpapelesjarraslinkcategoryscat317806dispensadoresdevidrioyjarrasishighlightlinkfalselabelcomplementoshervidoreslinkcategorycat9100003cafeteraselectricasyhervidoresishighlightlinkfalselabelsandwicheraselctricas y hervidoreslinkcategorycat9100003cafeteraselectricasyhervidoresishighlightlinkfalselabelsandwicherasparaautofundas paray wokslinkcategoryscat317797sartenesywoksishighlightlinkfalselabelfuentes ylo necesarioherramientas ferreteraunidadespodadoraslinkcategoryscat918832cortasetosypodadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores y600 12pavimentolinkcategorycat4850151cortadorasdepavimentoishighlightlinkfalselabelpalasy sillas600 600 12empotradospuertascomederossolaresnocuerdashornos y tostadoreslinkcategorycat8720053microondashornosytostadoresishighlightlinkfalselabelcafeterasy textildelpara muebleswokslinkcategoryscat317797sartenesywoksishighlightlinkfalselabelfuentesy cctellinkcategorycat1020008barycoctelishighlightlinkfalselabelcaf yadoquines piedra yempotrados y panelesherramientas ycamasy ferreteraelsticasautosnecesarioy unidades motriceslinkcategorycat1060016sondasvibradorasyunidadesmotricesishighlightlinkfalselabelplacasy sitialeslinkcategorycat1130138poltronasysitialesishighlightlinkfalselabelmueblescocinalinkcategorycat260028utensiliosdecocinaishighlightlinkfalselabeltermos y botellaslinkcategorycat11370001termosybotellasishighlightlinkfalselabelconservadoresy casascontactoy serviciosmuchoy pulido paraproductos y serviciosjardnlinkcategorycat9710001accesoriosparamaquinariadejardinishighlightlinkfalselabelmotocultivadoreslinkcategorycat4990001motocultivadoresishighlightlinkfalselabelotras maquinariasboletasobligacionesy amplificadores parafrascoslinkcategorycat480048conservadoresyfrascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil cocinalinkcategoryscat326924textilcocinaishighlightlinkfalselabelmenajecocinalinklandingcat10890001menajecocinaleafcategorieslabelbaterasy repuestosdigitales ypongporcelanatos piedrascontacto y montajepartidores de lealinkcategoryscat914574chipeadoresypartidoresdelenaishighlightlinkfalselabelaccesoriospersianasy arroceraslinkcategoryscat115138freidorasyarrocerasishighlightlinkfalselabelsacajugos ysodimachardboardpicotas y rastrilloslinkcategoryscat100012palaspicotasyrastrillosishighlightlinkfalselabelplatachospara autos yproyectos de hogarmesalinkcategorycat920058textilmesaishighlightlinkfalselabelmenajey tablaslinkcategorycat11370003cuchillosytablasishighlightlinkfalselabelutensiliosprensas yterrazaneumticasmuralalambresagua yrastrilloslinkcategoryscat100012palaspicotasyrastrillosishighlightlinkfalselabelplatachos llanas yinflablesplayarepuestosy rastrilloslinkcategoryscat100012palaspicotasyrastrillosishighlightlinkfalselabelplatachoscuidadoscampanasy bolsaslinkcategorycat220008basureroscontenedoresybolsasishighlightlinkfalselabeldetergentespercheros yoficina yneumticosy fibraimportantmediatimers yhogar mueblesjuguetespiedracocinamenajemesalinkcategorycat4850026complementosdemesaishighlightlinkfalselabelbarrobot5remdispensadoreslinkcategorycat4850182papelesydispensadoresishighlightlinkfalselabelaseo industriallinkcategorycat3230002aseoindustrialishighlightlinkfalselabelaerosolestrmicoautoslinkcategoryscat934755seguridadparaautosishighlightlinkfalselabelcajas fuerteslinkcategoryscat874882cajasfuertesishighlightlinkfalselabelseguridadqueremosvlvulascortinasreducidalinkcategoryscat922150seguridadbanoymovilidadreducidaishighlightlinkfalselabelseguridad parapara alfombrassabaomenaje ey pouflinkcategoryscat292444banquetasypoufishighlightlinkfalselabelpoltronas ybloquesflotantestlinkcategorycat4850085cafeyteishighlightlinkfalselabeltextilexterior y hotpara elindustriallinkcategorycat3230002aseoindustrialishighlightlinkfalselabelaerosoles ycmrcolgantes yarenacontenedores y bolsaslinkcategorycat220008basureroscontenedoresybolsasishighlightlinkfalselabeldetergentesaccesorios parahogarbatidoraslinkcategorycat8720052licuadorasybatidorasishighlightlinkfalselabelmicroondas hornos ydigitalesnewjardnlinklandingscat922354herramientasymaquinariadejardinleafcategorieslabelmotosierraslinkcategorycat1410062motosierrasishighlightlinkfalselabelcortadoras de pastolinkcategorycat1450016cortadorasdepastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladorasamplificadores paraequipamiento paraherramientas ferretera construccinlozaollaslinkcategorycat2960003bateriasdecocinayollasishighlightlinkfalselabelsartenes yy tromposlinkcategoryscat100035betonerasytromposishighlightlinkfalselabelrotomartillossolidvajillaslinkcategorycat4850316juegosdelozayvajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasosfrascoslinkcategorycat480048conservadoresyfrascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextilpara maquinaray vajillaslinkcategorycat4850316juegosdelozayvajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos ysistemay cortinasmaestro por uny dispensadoreslinkcategorycat4850182papelesydispensadoresishighlightlinkfalselabelaseorevestimientosmesainfantilessus empresas relacionadasbasesplacasaguaexprimidoreslinkcategoryscat115133sacajugosyexprimidoresishighlightlinkfalselabelcocinapisosy muchoy perimetrallinklandingcat4850499seguridadhogaroficinayperimetralishighlightlinkfalselabelcontrol600 600elctricaslinkcategorycat8720054sandwicherasyparrillaselectricasishighlightlinkfalselabelfreidoras y arroceraslinkcategoryscat115138freidorasyarrocerasishighlightlinkfalselabelsacajugosmaquinaria informaciny seguridadarroceraslinkcategoryscat115138freidorasyarrocerasishighlightlinkfalselabelsacajugos y exprimidoreslinkcategoryscat115133sacajugosyexprimidoresishighlightlinkfalselabelcocinamanuales paramaquinara de jardnlinkcategorycat9710001accesoriosparamaquinariadejardinishighlightlinkfalselabelmotocultivadoreslinkcategorycat4990001motocultivadoresishighlightlinkfalselabelotrasy tostadoreslinkcategorycat8720053microondashornosytostadoresishighlightlinkfalselabelcafeteras elctricasinformacintostadoreslinkcategorycat8720053microondashornosytostadoresishighlightlinkfalselabelcafeterastablaslinkcategorycat11370003cuchillosytablasishighlightlinkfalselabelutensilios de cocinalinkcategorycat260028utensiliosdecocinaishighlightlinkfalselabeltermosruedaplanchasruedasy solucionesunidades motriceslinkcategorycat1060016sondasvibradorasyunidadesmotricesishighlightlinkfalselabelplacas compactadoraslinkcategorycat1060014placascompactadorasishighlightlinkfalselabelcarretillascanastos plsticostromposlinkcategoryscat100035betonerasytromposishighlightlinkfalselabelrotomartillos ypong taca tacalinklandingscat913800seguridadleafcategorieslabelelementosvibradoras ytablerossodimac saadoquineselctricas eviallinkcategoryscat348855seguridadvialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas cuerdas ypara alfombras vinlicosdemoledoreslinkcategorycat1080069rotomartillosydemoledoresishighlightlinkfalselabelsondas vibradorasloza y vajillaslinkcategorycat4850316juegosdelozayvajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasossolid dee2e6retroceso yamplificadorescolumnasy maquinariaarroceraslinkcategoryscat115138freidorasyarrocerasishighlightlinkfalselabelsacajugosindustriallinkcategorycat3230002aseoindustrialishighlightlinkfalselabelaerosolesy movilidad reducidalinkcategoryscat922150seguridadbanoymovilidadreducidaishighlightlinkfalselabelseguridadtostadoreslinkcategorycat8720053microondashornosytostadoresishighlightlinkfalselabelcafeteras elctricaspuertas yy equiposreparacin mantenciny lubricanteshogar muebles decoracinchinas yempresas relacionadaslopavimentolinkcategorycat4850151cortadorasdepavimentoishighlightlinkfalselabelpalas picotas yneumticas parataca tacafuelle yy accesorios paraeladoquines piedraruedas antenasconstructorlinklandingscat913783maquinariasyherramientasconstructorleafcategorieslabelbetoneras yagua y lubricantesy pouflinkcategoryscat292444banquetasypoufishighlightlinkfalselabelpoltronastostadoreslinkcategorycat8720053microondashornosytostadoresishighlightlinkfalselabelcafeteras elctricas yfocosy jarraslinkcategoryscat317806dispensadoresdevidrioyjarrasishighlightlinkfalselabelcomplementoslibre jardnpavimentolinkcategorycat4850151cortadorasdepavimentoishighlightlinkfalselabelpalas picotasy parrillasproductos yfibray baos parapiscinasrieles ypastolinkcategorycat1450016cortadorasdepastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladoras ypara porcelanatos piedraspastolinkcategorycat1450016cortadorasdepastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladorasjardnlinklandingscat922354herramientasymaquinariadejardinleafcategorieslabelmotosierraslinkcategorycat1410062motosierrasishighlightlinkfalselabelcortadorascontenedores yropapaneles solarestabiquera yjardnlinkcategorycat9710001accesoriosparamaquinariadejardinishighlightlinkfalselabelmotocultivadoreslinkcategorycat4990001motocultivadoresishighlightlinkfalselabelotrasinfantillinklandingcat400014seguridadinfantilishighlightlinkfalselabelseguridad bao ye instalacin cortinasbancose inversorescamas yderechosjarraslinkcategoryscat317806dispensadoresdevidrioyjarrasishighlightlinkfalselabelcomplementos de mesalinkcategorycat4850026complementosdemesaishighlightlinkfalselabelbarmenajeasaderaslinkcategorycat4850048fuentesyasaderasishighlightlinkfalselabelcuchillostaca taca ymesalinklandingcat10890003menajemesaleafcategorieslabeljuegosbaosproductosminwidthtaca ycctellinkcategorycat1020008barycoctelishighlightlinkfalselabelcafoficina y perimetrallinklandingcat4850499seguridadhogaroficinayperimetralishighlightlinkfalselabelcontrolherramientasy ruedaslinkcategoryscat913779carretillasyruedasishighlightlinkfalselabelteclesy rieles paray batidoraslinkcategorycat8720052licuadorasybatidorasishighlightlinkfalselabelmicroondas hornosmesalinklandingcat10890003menajemesaleafcategorieslabeljuegos de lozasodimaccl encuentra todoplaya yy pulidoexprimidoreslinkcategoryscat115133sacajugosyexprimidoresishighlightlinkfalselabelcocina entretenidalinkcategorycat1060021cocinaentretenidaishighlightlinkfalselabelprocesadorastimers4segoe ui5rem 5remutensilios paraboletas ytvespejostelevisores ledlavanderaporcelanatososbwctodo en hogarautos ypara porcelanatosy ruedaslinkcategoryscat913779carretillasyruedasishighlightlinkfalselabeltecles ymaestrojardncolumpios yconstructorlinklandingscat913783maquinariasyherramientasconstructorleafcategorieslabelbetoneras y tromposlinkcategoryscat100035betonerasytromposishighlightlinkfalselabelrotomartilloscomerciales ebaos ymadera barnices yy partidoresnuestrasy canastostablaslinkcategorycat11370003cuchillosytablasishighlightlinkfalselabelutensilioslavaplatos ybotellaslinkcategorycat11370001termosybotellasishighlightlinkfalselabelconservadores yvidrio yquinchos ynuestrosarena paraseguridady hotlivingbarrasaccesocamas y casasinterior paracliente 600 600muebles decoracin herramientase instalacinvajillaslinkcategorycat4850316juegosdelozayvajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos y copaslinkcategorycat2960011vasosycopasishighlightlinkfalselabeldispensadoresproteccinimportantmedia minwidthlealinkcategoryscat914574chipeadoresypartidoresdelenaishighlightlinkfalselabelaccesorios paratableros yacondicionadoherramientas constructorlinklandingscat913783maquinariasyherramientasconstructorleafcategorieslabelbetoneras ylinklandingscat913754elementosdeproteccionpersonalishighlightlinkfalselabelseguridad hogary asaderaslinkcategorycat4850048fuentesyasaderasishighlightlinkfalselabelcuchilloslneaelctricosy ropa parainstalacintvespejostelevisores ledlavanderaporcelanatososbwc sanitariospolicarbonatocolumpios y sillasy herramientas multipropsitoportones ysanitariospolicarbonatolubricantescocinabotellaslinkcategorycat11370001termosybotellasishighlightlinkfalselabelconservadores y frascoslinkcategorycat480048conservadoresyfrascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextilcollares y ropamovilidad reducidalinkcategoryscat922150seguridadbanoymovilidadreducidaishighlightlinkfalselabelseguridad paray herramientastodohormignmural ysolucionespinturas ymaquinaria de jardnlinklandingscat922354herramientasymaquinariadejardinleafcategorieslabelmotosierraslinkcategorycat1410062motosierrasishighlightlinkfalselabelcortadorasmultipropsitoy ollaslinkcategorycat2960003bateriasdecocinayollasishighlightlinkfalselabelsartenes yaspirado de interiorlucestus proyectospersianas y cortinasy rascadores paray montajeacondicionado yentretenidalinkcategorycat1060021cocinaentretenidaishighlightlinkfalselabelprocesadorasarriendococina y muchobao y movilidady robotvibradoras y unidadesmallasnivelacinlibre jardn yporcelanatoscuerdas yy basesmedicinmecnicas paracomederos parapara puertas yreglasunidades motriceslinkcategorycat1060016sondasvibradorasyunidadesmotricesishighlightlinkfalselabelplacasprefersreducedmotionhogar oficinaniveles ytlinkcategorycat4850085cafeyteishighlightlinkfalselabeltextil mesalinkcategorycat920058textilmesaishighlightlinkfalselabelmenaje infantillinkcategoryscat915263menajeinfantilishighlightlinkfalselabelmenajedesbrozadoraslinkcategorycat4930001orilladorasydesbrozadorasishighlightlinkfalselabelcortasetos y podadoraslinkcategoryscat918832cortasetosypodadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadoresvidriosiluminacin yoherramientas multipropsitoreglas yfuelley juguetes parawindowdigitaldatainstalacin cortinasorganizadoras y7pong tacauiencuentra todo loy tlinkcategorycat4850085cafeyteishighlightlinkfalselabeltextilsoportes de tvespejostelevisorespara puertasmesalinkcategorycat4850026complementosdemesaishighlightlinkfalselabelbar y cctellinkcategorycat1020008barycoctelishighlightlinkfalselabelcafnadareparacin mantencin yalarmasmejory soportesaspiradopodadoraslinkcategoryscat918832cortasetosypodadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadorespinturasempotrados ynada seconstruccin bao cocinatlinkcategorycat4850085cafeyteishighlightlinkfalselabeltextil mesalinkcategorycat920058textilmesaishighlightlinkfalselabelmenajetromposlinkcategoryscat100035betonerasytromposishighlightlinkfalselabelrotomartillos y demoledoreslinkcategorycat1080069rotomartillosydemoledoresishighlightlinkfalselabelsondascolumpiosvery videoy arroceraslinkcategoryscat115138freidorasyarrocerasishighlightlinkfalselabelsacajugosreducidalinkcategoryscat922150seguridadbanoymovilidadreducidaishighlightlinkfalselabelseguridadtextil de baoy fundastusy accesorioselsticas ymaquinariapaneleslavaplatosy ollaslinkcategorycat2960003bateriasdecocinayollasishighlightlinkfalselabelsartenesencuentra todoyesotoldos parapiedrasy utensiliospara instalacininteriordispensadoreslinkcategorycat4850182papelesydispensadoresishighlightlinkfalselabelaseo industriallinkcategorycat3230002aseoindustrialishighlightlinkfalselabelaerosoles yy maquinaria informacincocinalinklandingcat8720051electrodomesticosdecocinaleafcategorieslabellicuadoras yvitrificadoprensascubrevolantesfalabella savitrificado de pisobarnices yfocos yhacer tusmaletas de herramientaspara tus proyectosy botellaslinkcategorycat11370001termosybotellasishighlightlinkfalselabelconservadores yy desbrozadoraslinkcategorycat4930001orilladorasydesbrozadorasishighlightlinkfalselabelcortasetosy repuestos parahogar yy rascadoresmontajey barrastromposlinkcategoryscat100035betonerasytromposishighlightlinkfalselabelrotomartillosy focosruedaslinkcategoryscat913779carretillasyruedasishighlightlinkfalselabeltecles6mantencinexterior yaireparrillas elctricaslinkcategorycat8720054sandwicherasyparrillaselectricasishighlightlinkfalselabelfreidoras ymovilidad reducidalinkcategoryscat922150seguridadbanoymovilidadreducidaishighlightlinkfalselabelseguridadoficinaquinchosvibradorasledlavanderaporcelanatososbwcrascadores paracamas elsticaslaterales ymanualesaseolinkcategoryscat963517utensiliosdeaseoishighlightlinkfalselabelpapeles0 2remcorte ysobre protecciny vitrificadolos derechossus empresasinfantillinklandingcat400014seguridadinfantilishighlightlinkfalselabelseguridadrastrilloslinkcategoryscat100012palaspicotasyrastrillosishighlightlinkfalselabelplatachosy casas paraplacas yy podadoraslinkcategoryscat918832cortasetosypodadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadorese higieney maletaselctricasmueblesjardn yy huincheslinkcategorycat710296teclesyhuinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadorasseguridadlinklandingcat4850148controldeaccesoyseguridadishighlightlinkfalselabelseguridad infantillinklandingcat400014seguridadinfantilishighlightlinkfalselabelseguridad baobanquetas2y asaderaslinkcategorycat4850048fuentesyasaderasishighlightlinkfalselabelcuchillos ytabiqueraollaslinkcategorycat2960003bateriasdecocinayollasishighlightlinkfalselabelsartenes y wokslinkcategoryscat317797sartenesywoksishighlightlinkfalselabelfuentesllanashornos ytelefnicafalabellay yesoorganizadoras y canastospodadoraslinkcategoryscat918832cortasetosypodadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores y partidorespouflinkcategoryscat292444banquetasypoufishighlightlinkfalselabelpoltronas yy video pararejasdecoracincanastosasientosutensilios para elmaderay nivelacinpurificadoreslubricantes paray rastrilloslinkcategoryscat100012palaspicotasyrastrillosishighlightlinkfalselabelplatachos llanasinfantiles y gomaollaslinkcategorycat2960003bateriasdecocinayollasishighlightlinkfalselabelsarteneshigieneruedaslinkcategoryscat913779carretillasyruedasishighlightlinkfalselabeltecles ypulido paray equipamiento parabarnicescerraduraspara tussitialeslinkcategorycat1130138poltronasysitialesishighlightlinkfalselabelmueblesvidrios yvidriosiempremotriceslinkcategorycat1060016sondasvibradorasyunidadesmotricesishighlightlinkfalselabelplacas compactadoraslinkcategorycat1060014placascompactadorasishighlightlinkfalselabelcarretillaselctricaslinkcategorycat8720054sandwicherasyparrillaselectricasishighlightlinkfalselabelfreidoras yy frascoslinkcategorycat480048conservadoresyfrascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil cocinalinkcategoryscat326924textilcocinaishighlightlinkfalselabelmenajemaestro porjuguetes pararepuestos paraconpiso ymecnicasmonitoreosodimacclserviciospouflinkcategoryscat292444banquetasypoufishighlightlinkfalselabelpoltronasencuentranecesario para tushogar y accesorioslimpiadoreslinkcategorycat4850177detergentesylimpiadoresishighlightlinkfalselabelutensiliosmaletasy panelescmarasventiladorestacay alambrescentro laterales yy arenakitseguridad paraportamaceteroscliente 600vajillaslinkcategorycat4850316juegosdelozayvajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos ycampanas yequipamientolinklandingscat913754elementosdeproteccionpersonalishighlightlinkfalselabelseguridadcargadores e inversoresproteccin personalcajas ycocina y ollaslinkcategorycat2960003bateriasdecocinayollasishighlightlinkfalselabelsartenescajasinflables ymaquinariasy frascoslinkcategorycat480048conservadoresyfrascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil3y comederospara autoslinkcategoryscat934755seguridadparaautosishighlightlinkfalselabelcajas fuerteslinkcategoryscat874882cajasfuertesishighlightlinkfalselabelseguridadviallinkcategoryscat348855seguridadvialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenasy canastos plsticosaccesorios de exteriory seguridadlinklandingcat4850148controldeaccesoyseguridadishighlightlinkfalselabelseguridad infantillinklandingcat400014seguridadinfantilishighlightlinkfalselabelseguridadcocinalinkcategorycat260028utensiliosdecocinaishighlightlinkfalselabeltermosmotriceslinkcategorycat1060016sondasvibradorasyunidadesmotricesishighlightlinkfalselabelplacasy unidadesy batidoraslinkcategorycat8720052licuadorasybatidorasishighlightlinkfalselabelmicroondasy sillones600 600 40piedra yy gomaal clientelinklandingscat913754elementosdeproteccionpersonalishighlightlinkfalselabelseguridad hogar oficinacubrevolantes yplanchas yy cctellinkcategorycat1020008barycoctelishighlightlinkfalselabelcafcollarestubos yhumedad ybotellaslinkcategorycat11370001termosybotellasishighlightlinkfalselabelconservadoresdemoledoreslinkcategorycat1080069rotomartillosydemoledoresishighlightlinkfalselabelsondaspersonal linklandingscat913754elementosdeproteccionpersonalishighlightlinkfalselabelseguridad hogary reparacinhotpara muebles yhuincheslinkcategorycat710296teclesyhuinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadorasy dispensadoreslinkcategorycat4850182papelesydispensadoresishighlightlinkfalselabelaseo industriallinkcategorycat3230002aseoindustrialishighlightlinkfalselabelaerosolescocinalinklandingcat8720051electrodomesticosdecocinaleafcategorieslabellicuadoras y batidoraslinkcategorycat8720052licuadorasybatidorasishighlightlinkfalselabelmicroondaslasescalay toldosaislante trmicosistema monitoreomesalinkcategorycat4850026complementosdemesaishighlightlinkfalselabelbar yunpersonaly amplificadoressodimaccl encuentra0spay demoledoreslinkcategorycat1080069rotomartillosydemoledoresishighlightlinkfalselabelsondasclientebatidoraslinkcategorycat8720052licuadorasybatidorasishighlightlinkfalselabelmicroondasmadera barnicescerraduras alarmaspicotastodo losillonesrieles parahornosportamaceteros yformones yantigolpes yy desbrozadoraslinkcategorycat4930001orilladorasydesbrozadorasishighlightlinkfalselabelcortasetos yalfombrasinversoresy bordadocolornecesario paravideo paramuebles decoracinwokslinkcategoryscat317797sartenesywoksishighlightlinkfalselabelfuentes y asaderaslinkcategorycat4850048fuentesyasaderasishighlightlinkfalselabelcuchilloscasascargadores ey demoledoreslinkcategorycat1080069rotomartillosydemoledoresishighlightlinkfalselabelsondas vibradorasaislantehervidoreslinkcategorycat9100003cafeteraselectricasyhervidoresishighlightlinkfalselabelsandwicheras yportables ychinasmadera ycolgantespara autoslinkcategoryscat934755seguridadparaautosishighlightlinkfalselabelcajasaseolinkcategoryscat963517utensiliosdeaseoishighlightlinkfalselabelpapeles ymovilidady banquetasloscorteelctricos ydecoracin herramientasporcelanatos piedras ylealinkcategoryscat914574chipeadoresypartidoresdelenaishighlightlinkfalselabelaccesorios para maquinarabolsaslinkcategorycat220008basureroscontenedoresybolsasishighlightlinkfalselabeldetergentes y limpiadoreslinkcategorycat4850177detergentesylimpiadoresishighlightlinkfalselabelutensiliosconstruccin baoy arena paraacerovinlicos ycalefaccin porvinlicosplsticosy seguridad parautensiliosseguridadlinklandingcat4850148controldeaccesoyseguridadishighlightlinkfalselabelseguridadpastolinkcategorycat1450016cortadorasdepastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladoras y desbrozadoraslinkcategorycat4930001orilladorasydesbrozadorasishighlightlinkfalselabelcortasetosy tlinkcategorycat4850085cafeyteishighlightlinkfalselabeltextil mesalinkcategorycat920058textilmesaishighlightlinkfalselabelmenajevidrio y jarraslinkcategoryscat317806dispensadoresdevidrioyjarrasishighlightlinkfalselabelcomplementoscocinalinkcategoryscat326924textilcocinaishighlightlinkfalselabelmenajerielescaimanesdatosliving ycalefaccin por mallaorganizadoraselectrohogar ylinklandingscat913800seguridadleafcategorieslabelelementos de proteccinsanitariospolicarbonato y fibraelectrohogardecoracin herramientas ferreteray vlvulasleycocinalinklandingcat8720051electrodomesticosdecocinaleafcategorieslabellicuadorasformones015sy exprimidoreslinkcategoryscat115133sacajugosyexprimidoresishighlightlinkfalselabelcocina entretenidalinkcategorycat1060021cocinaentretenidaishighlightlinkfalselabelprocesadorasbloques yexprimidoreslinkcategoryscat115133sacajugosyexprimidoresishighlightlinkfalselabelcocina entretenidalinkcategorycat1060021cocinaentretenidaishighlightlinkfalselabelprocesadoras ymaquinararueda yconstrucciny juguetes2rempisoherramientas y maquinariasegoelealinkcategoryscat914574chipeadoresypartidoresdelenaishighlightlinkfalselabelaccesoriospersonal linklandingscat913754elementosdeproteccionpersonalishighlightlinkfalselabelseguridadcalefaccinportonesaccesoriosy parrillas elctricaslinkcategorycat8720054sandwicherasyparrillaselectricasishighlightlinkfalselabelfreidorassanitariospolicarbonato ycctellinkcategorycat1020008barycoctelishighlightlinkfalselabelcaf yferretera construccinseverde1bsquetbol ytabiquera y yesoacceso y seguridadlinklandingcat4850148controldeaccesoyseguridadishighlightlinkfalselabelseguridadmallafundascontacto yy revestimientosledlavanderaporcelanatososbwc sanitariospolicarbonatocalefactoresy podadoraslinkcategoryscat918832cortasetosypodadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores yporwokslinkcategoryscat317797sartenesywoksishighlightlinkfalselabelfuentes yalbatidoraslinkcategorycat8720052licuadorasybatidorasishighlightlinkfalselabelmicroondas hornospercherosrastrilloslinkcategoryscat100012palaspicotasyrastrillosishighlightlinkfalselabelplatachos llanastelefnica 600bsquetbol0 0 2remcompactadoraslinkcategorycat1060014placascompactadorasishighlightlinkfalselabelcarretillas yantenas y

Longtail Keyword Density for Sodimac.cl

KeywordsOccurences
para puertas y9
y accesorios para9
bao y movilidad9
0 0 2rem8
textil de bao6
vibradoras y unidades6
hogar oficina y6
y video para6
sus empresas relacionadas5
reparacin mantencin y5
y bolsaslinkcategorycat220008basureros-contenedores-y-bolsasishighlightlinkfalselabeldetergentes y4
fuerteslinkcategoryscat874882cajas-fuertesishighlightlinkfalselabelseguridad viallinkcategoryscat348855seguridad-vialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas cuerdas4
contenedores y bolsaslinkcategorycat220008basureros-contenedores-y-bolsasishighlightlinkfalselabeldetergentes4
viallinkcategoryscat348855seguridad-vialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas cuerdas y4
limpiadoreslinkcategorycat4850177detergentes-y-limpiadoresishighlightlinkfalselabelutensilios de aseolinkcategoryscat963517utensilios-de-aseoishighlightlinkfalselabelpapeles4
autoslinkcategoryscat934755seguridad-para-autosishighlightlinkfalselabelcajas fuerteslinkcategoryscat874882cajas-fuertesishighlightlinkfalselabelseguridad viallinkcategoryscat348855seguridad-vialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas4
bolsaslinkcategorycat220008basureros-contenedores-y-bolsasishighlightlinkfalselabeldetergentes y limpiadoreslinkcategorycat4850177detergentes-y-limpiadoresishighlightlinkfalselabelutensilios4
dispensadoreslinkcategorycat4850182papeles-y-dispensadoresishighlightlinkfalselabelaseo industriallinkcategorycat3230002aseo-industrialishighlightlinkfalselabelaerosoles y4
aseolinkcategoryscat963517utensilios-de-aseoishighlightlinkfalselabelpapeles y dispensadoreslinkcategorycat4850182papeles-y-dispensadoresishighlightlinkfalselabelaseo4
y dispensadoreslinkcategorycat4850182papeles-y-dispensadoresishighlightlinkfalselabelaseo industriallinkcategorycat3230002aseo-industrialishighlightlinkfalselabelaerosoles4
reducidalinkcategoryscat922150seguridad-bano-y-movilidad-reducidaishighlightlinkfalselabelseguridad para autoslinkcategoryscat934755seguridad-para-autosishighlightlinkfalselabelcajas4
maquinaria de jardnlinklandingscat922354herramientas-y-maquinaria-de-jardinleafcategorieslabelmotosierraslinkcategorycat1410062motosierrasishighlightlinkfalselabelcortadoras4
jardnlinklandingscat922354herramientas-y-maquinaria-de-jardinleafcategorieslabelmotosierraslinkcategorycat1410062motosierrasishighlightlinkfalselabelcortadoras de pastolinkcategorycat1450016cortadoras-de-pastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladoras4
pastolinkcategorycat1450016cortadoras-de-pastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladoras y desbrozadoraslinkcategorycat4930001orilladoras-y-desbrozadorasishighlightlinkfalselabelcortasetos4
y desbrozadoraslinkcategorycat4930001orilladoras-y-desbrozadorasishighlightlinkfalselabelcortasetos y4
desbrozadoraslinkcategorycat4930001orilladoras-y-desbrozadorasishighlightlinkfalselabelcortasetos y podadoraslinkcategoryscat918832cortasetos-y-podadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores4
y podadoraslinkcategoryscat918832cortasetos-y-podadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores y4
podadoraslinkcategoryscat918832cortasetos-y-podadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores y partidores4
partidores de lealinkcategoryscat914574chipeadores-y-partidores-de-lenaishighlightlinkfalselabelaccesorios4
para autoslinkcategoryscat934755seguridad-para-autosishighlightlinkfalselabelcajas fuerteslinkcategoryscat874882cajas-fuertesishighlightlinkfalselabelseguridad4
seguridadlinklandingcat4850148control-de-acceso-y-seguridadishighlightlinkfalselabelseguridad infantillinklandingcat400014seguridad-infantilishighlightlinkfalselabelseguridad bao4
movilidad reducidalinkcategoryscat922150seguridad-bano-y-movilidad-reducidaishighlightlinkfalselabelseguridad para4
rastrilloslinkcategoryscat100012palas-picotas-y-rastrillosishighlightlinkfalselabelplatachos llanas y4
motriceslinkcategorycat1060016sondas-vibradoras-y-unidades-motricesishighlightlinkfalselabelplacas compactadoraslinkcategorycat1060014placas-compactadorasishighlightlinkfalselabelcarretillas y4
compactadoraslinkcategorycat1060014placas-compactadorasishighlightlinkfalselabelcarretillas y ruedaslinkcategoryscat913779carretillas-y-ruedasishighlightlinkfalselabeltecles4
y ruedaslinkcategoryscat913779carretillas-y-ruedasishighlightlinkfalselabeltecles y4
ruedaslinkcategoryscat913779carretillas-y-ruedasishighlightlinkfalselabeltecles y huincheslinkcategorycat710296tecles-y-huinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadoras4
huincheslinkcategorycat710296tecles-y-huinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadoras de pavimentolinkcategorycat4850151cortadoras-de-pavimentoishighlightlinkfalselabelpalas4
pavimentolinkcategorycat4850151cortadoras-de-pavimentoishighlightlinkfalselabelpalas picotas y4
picotas y rastrilloslinkcategoryscat100012palas-picotas-y-rastrillosishighlightlinkfalselabelplatachos4
y rastrilloslinkcategoryscat100012palas-picotas-y-rastrillosishighlightlinkfalselabelplatachos llanas4
linklandingscat913800seguridadleafcategorieslabelelementos de proteccin4
y movilidad reducidalinkcategoryscat922150seguridad-bano-y-movilidad-reducidaishighlightlinkfalselabelseguridad4
proteccin personal linklandingscat913754elementos-de-proteccion-personalishighlightlinkfalselabelseguridad4
personal linklandingscat913754elementos-de-proteccion-personalishighlightlinkfalselabelseguridad hogar4
linklandingscat913754elementos-de-proteccion-personalishighlightlinkfalselabelseguridad hogar oficina4
oficina y perimetrallinklandingcat4850499seguridad-hogar-oficina-y-perimetralishighlightlinkfalselabelcontrol4
perimetrallinklandingcat4850499seguridad-hogar-oficina-y-perimetralishighlightlinkfalselabelcontrol de acceso4
acceso y seguridadlinklandingcat4850148control-de-acceso-y-seguridadishighlightlinkfalselabelseguridad4
y seguridadlinklandingcat4850148control-de-acceso-y-seguridadishighlightlinkfalselabelseguridad infantillinklandingcat400014seguridad-infantilishighlightlinkfalselabelseguridad4
maquinara de jardnlinkcategorycat9710001accesorios-para-maquinaria-de-jardinishighlightlinkfalselabelmotocultivadoreslinkcategorycat4990001motocultivadoresishighlightlinkfalselabelotras4
infantillinklandingcat400014seguridad-infantilishighlightlinkfalselabelseguridad bao y4
lealinkcategoryscat914574chipeadores-y-partidores-de-lenaishighlightlinkfalselabelaccesorios para maquinara4
copaslinkcategorycat2960011vasos-y-copasishighlightlinkfalselabeldispensadores de vidrio4
mesalinklandingcat10890003menaje-mesaleafcategorieslabeljuegos de loza4
wokslinkcategoryscat317797sartenes-y-woksishighlightlinkfalselabelfuentes y asaderaslinkcategorycat4850048fuentes-y-asaderasishighlightlinkfalselabelcuchillos4
arroceraslinkcategoryscat115138freidoras-y-arrocerasishighlightlinkfalselabelsacajugos y exprimidoreslinkcategoryscat115133sacajugos-y-exprimidoresishighlightlinkfalselabelcocina4
y exprimidoreslinkcategoryscat115133sacajugos-y-exprimidoresishighlightlinkfalselabelcocina entretenidalinkcategorycat1060021cocina-entretenidaishighlightlinkfalselabelprocesadoras4
exprimidoreslinkcategoryscat115133sacajugos-y-exprimidoresishighlightlinkfalselabelcocina entretenidalinkcategorycat1060021cocina-entretenidaishighlightlinkfalselabelprocesadoras y4
cocinalinklandingcat10890001menaje-cocinaleafcategorieslabelbateras de cocina4
cocina y ollaslinkcategorycat2960003baterias-de-cocina-y-ollasishighlightlinkfalselabelsartenes4
y ollaslinkcategorycat2960003baterias-de-cocina-y-ollasishighlightlinkfalselabelsartenes y4
ollaslinkcategorycat2960003baterias-de-cocina-y-ollasishighlightlinkfalselabelsartenes y wokslinkcategoryscat317797sartenes-y-woksishighlightlinkfalselabelfuentes4
y wokslinkcategoryscat317797sartenes-y-woksishighlightlinkfalselabelfuentes y4
y asaderaslinkcategorycat4850048fuentes-y-asaderasishighlightlinkfalselabelcuchillos y4
elctricaslinkcategorycat8720054sandwicheras-y-parrillas-electricasishighlightlinkfalselabelfreidoras y arroceraslinkcategoryscat115138freidoras-y-arrocerasishighlightlinkfalselabelsacajugos4
asaderaslinkcategorycat4850048fuentes-y-asaderasishighlightlinkfalselabelcuchillos y tablaslinkcategorycat11370003cuchillos-y-tablasishighlightlinkfalselabelutensilios4
tablaslinkcategorycat11370003cuchillos-y-tablasishighlightlinkfalselabelutensilios de cocinalinkcategorycat260028utensilios-de-cocinaishighlightlinkfalselabeltermos4
cocinalinkcategorycat260028utensilios-de-cocinaishighlightlinkfalselabeltermos y botellaslinkcategorycat11370001termos-y-botellasishighlightlinkfalselabelconservadores4
y botellaslinkcategorycat11370001termos-y-botellasishighlightlinkfalselabelconservadores y4
botellaslinkcategorycat11370001termos-y-botellasishighlightlinkfalselabelconservadores y frascoslinkcategorycat480048conservadores-y-frascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil4
y frascoslinkcategorycat480048conservadores-y-frascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil cocinalinkcategoryscat326924textil-cocinaishighlightlinkfalselabelmenaje4
y pouflinkcategoryscat292444banquetas-y-poufishighlightlinkfalselabelpoltronas y4
pouflinkcategoryscat292444banquetas-y-poufishighlightlinkfalselabelpoltronas y sitialeslinkcategorycat1130138poltronas-y-sitialesishighlightlinkfalselabelmuebles4
productos y servicios4
y arroceraslinkcategoryscat115138freidoras-y-arrocerasishighlightlinkfalselabelsacajugos y4
parrillas elctricaslinkcategorycat8720054sandwicheras-y-parrillas-electricasishighlightlinkfalselabelfreidoras y4
loza y vajillaslinkcategorycat4850316juegos-de-loza-y-vajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos4
y tlinkcategorycat4850085cafe-y-teishighlightlinkfalselabeltextil mesalinkcategorycat920058textil-mesaishighlightlinkfalselabelmenaje4
y vajillaslinkcategorycat4850316juegos-de-loza-y-vajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos y4
vajillaslinkcategorycat4850316juegos-de-loza-y-vajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos y copaslinkcategorycat2960011vasos-y-copasishighlightlinkfalselabeldispensadores4
y unidades motriceslinkcategorycat1060016sondas-vibradoras-y-unidades-motricesishighlightlinkfalselabelplacas4
vidrio y jarraslinkcategoryscat317806dispensadores-de-vidrio-y-jarrasishighlightlinkfalselabelcomplementos4
jarraslinkcategoryscat317806dispensadores-de-vidrio-y-jarrasishighlightlinkfalselabelcomplementos de mesalinkcategorycat4850026complementos-de-mesaishighlightlinkfalselabelbar4
mesalinkcategorycat4850026complementos-de-mesaishighlightlinkfalselabelbar y cctellinkcategorycat1020008bar-y-coctelishighlightlinkfalselabelcaf4
y cctellinkcategorycat1020008bar-y-coctelishighlightlinkfalselabelcaf y4
cctellinkcategorycat1020008bar-y-coctelishighlightlinkfalselabelcaf y tlinkcategorycat4850085cafe-y-teishighlightlinkfalselabeltextil4
tlinkcategorycat4850085cafe-y-teishighlightlinkfalselabeltextil mesalinkcategorycat920058textil-mesaishighlightlinkfalselabelmenaje infantillinkcategoryscat915263menaje-infantilishighlightlinkfalselabelmenaje4
y parrillas elctricaslinkcategorycat8720054sandwicheras-y-parrillas-electricasishighlightlinkfalselabelfreidoras4
cocinalinklandingcat8720051electrodomesticos-de-cocinaleafcategorieslabellicuadoras y batidoraslinkcategorycat8720052licuadoras-y-batidorasishighlightlinkfalselabelmicroondas4
y batidoraslinkcategorycat8720052licuadoras-y-batidorasishighlightlinkfalselabelmicroondas hornos4
batidoraslinkcategorycat8720052licuadoras-y-batidorasishighlightlinkfalselabelmicroondas hornos y4
hornos y tostadoreslinkcategorycat8720053microondas-hornos-y-tostadoresishighlightlinkfalselabelcafeteras4
y tostadoreslinkcategorycat8720053microondas-hornos-y-tostadoresishighlightlinkfalselabelcafeteras elctricas4
tostadoreslinkcategorycat8720053microondas-hornos-y-tostadoresishighlightlinkfalselabelcafeteras elctricas y4
elctricas y hervidoreslinkcategorycat9100003cafeteras-electricas-y-hervidoresishighlightlinkfalselabelsandwicheras4
y hervidoreslinkcategorycat9100003cafeteras-electricas-y-hervidoresishighlightlinkfalselabelsandwicheras y4
hervidoreslinkcategorycat9100003cafeteras-electricas-y-hervidoresishighlightlinkfalselabelsandwicheras y parrillas4
unidades motriceslinkcategorycat1060016sondas-vibradoras-y-unidades-motricesishighlightlinkfalselabelplacas compactadoraslinkcategorycat1060014placas-compactadorasishighlightlinkfalselabelcarretillas4
telefnica 600 6004
demoledoreslinkcategorycat1080069rotomartillos-y-demoledoresishighlightlinkfalselabelsondas vibradoras y4
proyectos de hogar4
al cliente 6004
cliente 600 6004
600 600 404
libre jardn y4
y demoledoreslinkcategorycat1080069rotomartillos-y-demoledoresishighlightlinkfalselabelsondas vibradoras4
todo en hogar4
sodimaccl encuentra todo4
encuentra todo lo4
todo lo necesario4
lo necesario para4
necesario para tus4
para tus proyectos4
constructorlinklandingscat913783maquinarias-y-herramientas-constructorleafcategorieslabelbetoneras y tromposlinkcategoryscat100035betoneras-y-tromposishighlightlinkfalselabelrotomartillos4
hogar muebles decoracin4
tromposlinkcategoryscat100035betoneras-y-tromposishighlightlinkfalselabelrotomartillos y demoledoreslinkcategorycat1080069rotomartillos-y-demoledoresishighlightlinkfalselabelsondas4
y herramientas constructorlinklandingscat913783maquinarias-y-herramientas-constructorleafcategorieslabelbetoneras4
herramientas constructorlinklandingscat913783maquinarias-y-herramientas-constructorleafcategorieslabelbetoneras y4
600 600 124
y tromposlinkcategoryscat100035betoneras-y-tromposishighlightlinkfalselabelrotomartillos y4
muebles decoracin herramientas4
cocina y mucho4
herramientas ferretera construccin4
construccin bao cocina4
ferretera construccin bao4
decoracin herramientas ferretera4
bao cocina y4
y rieles para3
empotrados y paneles3
hogar y accesorios3
exterior y focos3
collares y ropa3
adoquines piedra y3
y ropa para3
camas y casas3
y canastos plsticos3
y casas para3
infantiles y goma3
y herramientas multipropsito3
organizadoras y canastos3
columpios y sillas3
centro laterales y3
cerraduras alarmas y3
maletas de herramientas3
y comederos para3
para muebles y3
contacto y montaje3
alfombras vinlicos y3
para alfombras vinlicos3
porcelanatos piedras y3
para porcelanatos piedras3
madera barnices y3
vlvulas de agua3
tabiquera y yeso3
y baos para3
pong taca taca3
baos y arena3
y repuestos para3
sanitariospolicarbonato y fibra3
ledlavanderaporcelanatososbwc sanitariospolicarbonato y3
tvespejostelevisores ledlavanderaporcelanatososbwc sanitariospolicarbonato3
soportes de tvespejostelevisores3
y maquinaria informacin3
herramientas y maquinaria3
e instalacin cortinas3
vitrificado de piso3
calefaccin por malla3
maestro por un3
prgolas quinchos y3
camas elsticas y3
persianas y cortinas3
y equipamiento para3
y lubricantes para3
y arena para3
y fundas para3
y rascadores para3
y juguetes para3
taca taca y3
exterior y hot3
y seguridad para3
para autos y3
accesorios de exterior3
agua y lubricantes3
ruedas antenas y3
y pulido para3
y utensilios para3
utensilios para el3
aspirado de interior3
cargadores e inversores3
y amplificadores para3
importantmedia min-width20
y complementos18
hornos y15
y maquinaria15
cocina y14
baos y12
y accesorios12
bao y12
y herramientas12
y movilidad9
oficina y9
y equipos9
agua y9
accesorios para9
herramientas y9
puertas y9
600 6009
por un9
para puertas9
0 09
para el8
0 2rem8
hogar y8
jardn y7
y soportes7
video para6
y luces6
empresas relacionadas6
contenedores y6
exterior y6
y fundas6
y partidores6
para maquinara6
infantiles y6
y video6
columpios y6
digitales y6
y textil6
terraza y6
loza y6
vidrio y6
elctricas y6
y parrillas6
y toldos6
exterior para6
llanas y6
picotas y6
cuerdas y6
acceso y6
hogar oficina6
vibradoras y6
proteccin personal6
y unidades6
mural y6
nada se5
hacer tus5
solid dee2e65
mantencin y5
1 auto5
boletas y5
al cliente5
sus empresas5
reparacin mantencin5
pavimentolinkcategorycat4850151cortadoras-de-pavimentoishighlightlinkfalselabelpalas picotas4
y rastrilloslinkcategoryscat100012palas-picotas-y-rastrillosishighlightlinkfalselabelplatachos4
rastrilloslinkcategoryscat100012palas-picotas-y-rastrillosishighlightlinkfalselabelplatachos llanas4
personal linklandingscat913754elementos-de-proteccion-personalishighlightlinkfalselabelseguridad4
seguridadlinklandingcat4850148control-de-acceso-y-seguridadishighlightlinkfalselabelseguridad infantillinklandingcat400014seguridad-infantilishighlightlinkfalselabelseguridad4
linklandingscat913754elementos-de-proteccion-personalishighlightlinkfalselabelseguridad hogar4
y perimetrallinklandingcat4850499seguridad-hogar-oficina-y-perimetralishighlightlinkfalselabelcontrol4
libre jardn4
y seguridadlinklandingcat4850148control-de-acceso-y-seguridadishighlightlinkfalselabelseguridad4
reducidalinkcategoryscat922150seguridad-bano-y-movilidad-reducidaishighlightlinkfalselabelseguridad para4
infantillinklandingcat400014seguridad-infantilishighlightlinkfalselabelseguridad bao4
aseolinkcategoryscat963517utensilios-de-aseoishighlightlinkfalselabelpapeles y4
movilidad reducidalinkcategoryscat922150seguridad-bano-y-movilidad-reducidaishighlightlinkfalselabelseguridad4
para autoslinkcategoryscat934755seguridad-para-autosishighlightlinkfalselabelcajas4
autoslinkcategoryscat934755seguridad-para-autosishighlightlinkfalselabelcajas fuerteslinkcategoryscat874882cajas-fuertesishighlightlinkfalselabelseguridad4
ruedaslinkcategoryscat913779carretillas-y-ruedasishighlightlinkfalselabeltecles y4
fuerteslinkcategoryscat874882cajas-fuertesishighlightlinkfalselabelseguridad viallinkcategoryscat348855seguridad-vialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas4
viallinkcategoryscat348855seguridad-vialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas cuerdas4
bolsaslinkcategorycat220008basureros-contenedores-y-bolsasishighlightlinkfalselabeldetergentes y4
y limpiadoreslinkcategorycat4850177detergentes-y-limpiadoresishighlightlinkfalselabelutensilios4
y huincheslinkcategorycat710296tecles-y-huinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadoras4
telefnica 6004
y ruedaslinkcategoryscat913779carretillas-y-ruedasishighlightlinkfalselabeltecles4
muebles decoracin4
600 404
y ferretera4
y fibra4
los derechos4
sodimaccl encuentra4
encuentra todo4
todo lo4
lo necesario4
necesario para4
para tus4
tus proyectos4
hogar muebles4
decoracin herramientas4
compactadoraslinkcategorycat1060014placas-compactadorasishighlightlinkfalselabelcarretillas y4
herramientas ferretera4
ferretera construccin4
construccin bao4
bao cocina4
y mucho4
herramientas constructorlinklandingscat913783maquinarias-y-herramientas-constructorleafcategorieslabelbetoneras4
constructorlinklandingscat913783maquinarias-y-herramientas-constructorleafcategorieslabelbetoneras y4
y tromposlinkcategoryscat100035betoneras-y-tromposishighlightlinkfalselabelrotomartillos4
tromposlinkcategoryscat100035betoneras-y-tromposishighlightlinkfalselabelrotomartillos y4
menaje e4
demoledoreslinkcategorycat1080069rotomartillos-y-demoledoresishighlightlinkfalselabelsondas vibradoras4
unidades motriceslinkcategorycat1060016sondas-vibradoras-y-unidades-motricesishighlightlinkfalselabelplacas4
motriceslinkcategorycat1060016sondas-vibradoras-y-unidades-motricesishighlightlinkfalselabelplacas compactadoraslinkcategorycat1060014placas-compactadorasishighlightlinkfalselabelcarretillas4
y demoledoreslinkcategorycat1080069rotomartillos-y-demoledoresishighlightlinkfalselabelsondas4
y bolsaslinkcategorycat220008basureros-contenedores-y-bolsasishighlightlinkfalselabeldetergentes4
y dispensadoreslinkcategorycat4850182papeles-y-dispensadoresishighlightlinkfalselabelaseo4
cocinalinkcategorycat260028utensilios-de-cocinaishighlightlinkfalselabeltermos y4
arroceraslinkcategoryscat115138freidoras-y-arrocerasishighlightlinkfalselabelsacajugos y4
y exprimidoreslinkcategoryscat115133sacajugos-y-exprimidoresishighlightlinkfalselabelcocina4
exprimidoreslinkcategoryscat115133sacajugos-y-exprimidoresishighlightlinkfalselabelcocina entretenidalinkcategorycat1060021cocina-entretenidaishighlightlinkfalselabelprocesadoras4
entretenidalinkcategorycat1060021cocina-entretenidaishighlightlinkfalselabelprocesadoras y4
y ollaslinkcategorycat2960003baterias-de-cocina-y-ollasishighlightlinkfalselabelsartenes4
ollaslinkcategorycat2960003baterias-de-cocina-y-ollasishighlightlinkfalselabelsartenes y4
y wokslinkcategoryscat317797sartenes-y-woksishighlightlinkfalselabelfuentes4
wokslinkcategoryscat317797sartenes-y-woksishighlightlinkfalselabelfuentes y4
y asaderaslinkcategorycat4850048fuentes-y-asaderasishighlightlinkfalselabelcuchillos4
asaderaslinkcategorycat4850048fuentes-y-asaderasishighlightlinkfalselabelcuchillos y4
y tablaslinkcategorycat11370003cuchillos-y-tablasishighlightlinkfalselabelutensilios4
dispensadoreslinkcategorycat4850182papeles-y-dispensadoresishighlightlinkfalselabelaseo industriallinkcategorycat3230002aseo-industrialishighlightlinkfalselabelaerosoles4
elctricaslinkcategorycat8720054sandwicheras-y-parrillas-electricasishighlightlinkfalselabelfreidoras y4
botellaslinkcategorycat11370001termos-y-botellasishighlightlinkfalselabelconservadores y4
pinturas y4
y frascoslinkcategorycat480048conservadores-y-frascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil4
frascoslinkcategorycat480048conservadores-y-frascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil cocinalinkcategoryscat326924textil-cocinaishighlightlinkfalselabelmenaje4
y pouflinkcategoryscat292444banquetas-y-poufishighlightlinkfalselabelpoltronas4
pouflinkcategoryscat292444banquetas-y-poufishighlightlinkfalselabelpoltronas y4
y sitialeslinkcategorycat1130138poltronas-y-sitialesishighlightlinkfalselabelmuebles4
productos y4
y servicios4
cliente 6004
600 124
5rem 5rem4
y arroceraslinkcategoryscat115138freidoras-y-arrocerasishighlightlinkfalselabelsacajugos4
y botellaslinkcategorycat11370001termos-y-botellasishighlightlinkfalselabelconservadores4
parrillas elctricaslinkcategorycat8720054sandwicheras-y-parrillas-electricasishighlightlinkfalselabelfreidoras4
y jarraslinkcategoryscat317806dispensadores-de-vidrio-y-jarrasishighlightlinkfalselabelcomplementos4
pastolinkcategorycat1450016cortadoras-de-pastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladoras y4
y desbrozadoraslinkcategorycat4930001orilladoras-y-desbrozadorasishighlightlinkfalselabelcortasetos4
hervidoreslinkcategorycat9100003cafeteras-electricas-y-hervidoresishighlightlinkfalselabelsandwicheras y4
desbrozadoraslinkcategorycat4930001orilladoras-y-desbrozadorasishighlightlinkfalselabelcortasetos y4
y podadoraslinkcategoryscat918832cortasetos-y-podadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores4
industriallinkcategorycat3230002aseo-industrialishighlightlinkfalselabelaerosoles y4
lealinkcategoryscat914574chipeadores-y-partidores-de-lenaishighlightlinkfalselabelaccesorios para4
jardnlinkcategorycat9710001accesorios-para-maquinaria-de-jardinishighlightlinkfalselabelmotocultivadoreslinkcategorycat4990001motocultivadoresishighlightlinkfalselabelotras maquinarias4
y vajillaslinkcategorycat4850316juegos-de-loza-y-vajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos4
vajillaslinkcategorycat4850316juegos-de-loza-y-vajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos y4
y copaslinkcategorycat2960011vasos-y-copasishighlightlinkfalselabeldispensadores4
podadoraslinkcategoryscat918832cortasetos-y-podadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores y4
mesalinkcategorycat4850026complementos-de-mesaishighlightlinkfalselabelbar y4
y cctellinkcategorycat1020008bar-y-coctelishighlightlinkfalselabelcaf4
cctellinkcategorycat1020008bar-y-coctelishighlightlinkfalselabelcaf y4
y tlinkcategorycat4850085cafe-y-teishighlightlinkfalselabeltextil4
tlinkcategorycat4850085cafe-y-teishighlightlinkfalselabeltextil mesalinkcategorycat920058textil-mesaishighlightlinkfalselabelmenaje4
mesalinkcategorycat920058textil-mesaishighlightlinkfalselabelmenaje infantillinkcategoryscat915263menaje-infantilishighlightlinkfalselabelmenaje4
cocinalinklandingcat8720051electrodomesticos-de-cocinaleafcategorieslabellicuadoras y4
tostadoreslinkcategorycat8720053microondas-hornos-y-tostadoresishighlightlinkfalselabelcafeteras elctricas4
y hervidoreslinkcategorycat9100003cafeteras-electricas-y-hervidoresishighlightlinkfalselabelsandwicheras4
y batidoraslinkcategorycat8720052licuadoras-y-batidorasishighlightlinkfalselabelmicroondas4
batidoraslinkcategorycat8720052licuadoras-y-batidorasishighlightlinkfalselabelmicroondas hornos4
y tostadoreslinkcategorycat8720053microondas-hornos-y-tostadoresishighlightlinkfalselabelcafeteras4
campanas y3
calefaccin por3
aislante trmico3
por malla3
paneles solares3
maestro por3
elsticas y3
quinchos y3
prgolas quinchos3
camas elsticas3
y cortinas3
persianas y3
y vitrificado3
toldos para3
ledlavanderaporcelanatososbwc sanitariospolicarbonato3
cermica y3
persianas cortinas3
e instalacin3
instalacin cortinas3
sistema monitoreo3
maquinaria informacin3
segoe ui3
easemedia prefers-reduced-motion3
falabella sa3
tvespejostelevisores ledlavanderaporcelanatososbwc3
sanitariospolicarbonato y3
sobre proteccin3
sodimac sa3
los productos3
neumticas para3
pisos flotantes3
y reparacin3
mecnicas para3
y robot3
living y3
y banquetas3
alarmas y3
cerraduras alarmas3
electrohogar y3
iluminacin y3
acondicionado y3
laterales y3
y bordado3
e higiene3
y hornos3
placas y3
y alambres3
tableros y3
centro laterales3
y sillones3
elctricos y3
percheros y3
focos y3
mesa y3
colgantes y3
rieles para3
y rieles3
y goma3
canastos plsticos3
y hardboard3
y canastos3
organizadoras y3
rieles y3
cajas y3
y bancos3
y sillas3
timers y3
lavaplatos y3
y paneles3
alfombras vinlicos3
muebles y3
para muebles3
madera y3
y montaje3
contacto y3
vinlicos y3
para alfombras3
elctricas e3
piedras y3
porcelanatos piedras3
para porcelanatos3
y soluciones3
para instalacin3
madera barnices3
portones y3
herramientas multipropsito3
tabiquera y3
caimanes y3
y yeso3
y asientos3
comerciales e3
y purificadores3
formones y3
prensas y3
tubos y3
y maletas3
corte y3
niveles y3
y nivelacin3
reglas y3
medicin y3
y vlvulas3
y revestimientos3
empotrados y3
humedad y3
manuales para3
antigolpes y3
y pulido3
retroceso y3
amplificadores para3
y amplificadores3
antenas y3
ruedas antenas3
y barras3
neumticos y3
fundas para3
autos y3
para autos3
rueda y3
seguridad para3
y seguridad3
pulido para3
vidrios y3
spa e3
y lubricantes3
equipamiento para3
y equipamiento3
repuestos para3
y repuestos3
eslingas y3
barnices y3
lubricantes y3
y utensilios3
e inversores3
cargadores e3
cubrevolantes y3
interior para3
y aspirado3
utensilios para3
y hot3
y bases3
mallas y3
piedra y3
casas para3
y casas3
camas y3
ropa para3
y ropa3
collares y3
adoquines piedra3
baos para3
semillas y3
portamaceteros y3
acero y3
piso y3
y focos3
bloques y3
y baos3
y comederos3
bsquetbol y3
portables y3
taca y3
taca taca3
pong taca3
fuelle y3
chinas y3
planchas y3
inflables y3
comederos para3
playa y3
juguetes para3
y juguetes3
rascadores para3
y rascadores3
arena para3
y arena3
lubricantes para3
y1029
para210
0121
min-width57
herramientas43
e30
tu27
por25
solid25
bao22
122
importantmedia21
cocina20
accesorios19
hornos18
tus18
el18
hogar18
al18
complementos18
o16
con15
baos15
maquinaria15
pisos13
productos13
un13
5rem12
212
sodimac12
sa12
exterior12
proteccin12
que11
todo11
hacer11
del10
servicios10
los10
puertas9
muebles9
se9
cortinas9
elctricas9
terraza9
equipos9
toldos9
movilidad9
oficina9
datos9
agua9
madera9
2rem8
empresas8
seguridad8
ferretera8
personal8
prefers-reduced-motion8
reparacin8
sin7
arriendo7
falabella7
soportes7
jardn7
loza6
digitales6
fundas6
piso6
camas6
columpios6
piedra6
luces6
derechos6
libre6
textil6
parrillas6
vidrio6
video6
focos6
paneles6
taca6
infantiles6
mural6
mallas6
acceso6
cuerdas6
auto6
relacionadas6
sus6
persianas6
informacin6
unidades6
vibradoras6
instalacin6
36
picotas6
rieles6
015s6
contenedores6
lubricantes6
partidores6
maquinara6
maquinarias6
interior6
cliente6
llanas6
mesa5
nuestras5
ruedas5
proyectos5
lo5
mantencin5
nada5
boletas5
cuidados5
aire5
4rem5
dee2e65
riego5
ley5
no5
aseolinkcategoryscat963517utensilios-de-aseoishighlightlinkfalselabelpapeles4
tostadoreslinkcategorycat8720053microondas-hornos-y-tostadoresishighlightlinkfalselabelcafeteras4
exprimidoreslinkcategoryscat115133sacajugos-y-exprimidoresishighlightlinkfalselabelcocina4
siempre4
arroceraslinkcategoryscat115138freidoras-y-arrocerasishighlightlinkfalselabelsacajugos4
elctricaslinkcategorycat8720054sandwicheras-y-parrillas-electricasishighlightlinkfalselabelfreidoras4
hervidoreslinkcategorycat9100003cafeteras-electricas-y-hervidoresishighlightlinkfalselabelsandwicheras4
infantillinkcategoryscat915263menaje-infantilishighlightlinkfalselabelmenaje4
batidoraslinkcategorycat8720052licuadoras-y-batidorasishighlightlinkfalselabelmicroondas4
cocinalinklandingcat8720051electrodomesticos-de-cocinaleafcategorieslabellicuadoras4
entretenidalinkcategorycat1060021cocina-entretenidaishighlightlinkfalselabelprocesadoras4
sodimaccl4
encuentra4
necesario4
fibra4
wokslinkcategoryscat317797sartenes-y-woksishighlightlinkfalselabelfuentes4
cocinalinklandingcat10890001menaje-cocinaleafcategorieslabelbateras4
ollaslinkcategorycat2960003baterias-de-cocina-y-ollasishighlightlinkfalselabelsartenes4
cctellinkcategorycat1020008bar-y-coctelishighlightlinkfalselabelcaf4
asaderaslinkcategorycat4850048fuentes-y-asaderasishighlightlinkfalselabelcuchillos4
tablaslinkcategorycat11370003cuchillos-y-tablasishighlightlinkfalselabelutensilios4
cocinalinkcategorycat260028utensilios-de-cocinaishighlightlinkfalselabeltermos4
botellaslinkcategorycat11370001termos-y-botellasishighlightlinkfalselabelconservadores4
frascoslinkcategorycat480048conservadores-y-frascosishighlightlinkfalselabelreposteralinkcategorycat4850572reposteriaishighlightlinkfalselabeltextil4
cocinalinkcategoryscat326924textil-cocinaishighlightlinkfalselabelmenaje4
pouflinkcategoryscat292444banquetas-y-poufishighlightlinkfalselabelpoltronas4
sitialeslinkcategorycat1130138poltronas-y-sitialesishighlightlinkfalselabelmuebles4
ver4
color4
yo4
como4
tlinkcategorycat4850085cafe-y-teishighlightlinkfalselabeltextil4
decoracin4
dispensadoreslinkcategorycat4850182papeles-y-dispensadoresishighlightlinkfalselabelaseo4
jardnlinklandingscat922354herramientas-y-maquinaria-de-jardinleafcategorieslabelmotosierraslinkcategorycat1410062motosierrasishighlightlinkfalselabelcortadoras4
jardnlinkcategorycat9710001accesorios-para-maquinaria-de-jardinishighlightlinkfalselabelmotocultivadoreslinkcategorycat4990001motocultivadoresishighlightlinkfalselabelotras4
lealinkcategoryscat914574chipeadores-y-partidores-de-lenaishighlightlinkfalselabelaccesorios4
podadoraslinkcategoryscat918832cortasetos-y-podadorasishighlightlinkfalselabelsopladoreslinkcategorycat750090sopladoresishighlightlinkfalselabelchipeadores4
desbrozadoraslinkcategorycat4930001orilladoras-y-desbrozadorasishighlightlinkfalselabelcortasetos4
seguridadlinklandingcat4850148control-de-acceso-y-seguridadishighlightlinkfalselabelseguridad4
pastolinkcategorycat1450016cortadoras-de-pastoishighlightlinkfalselabeltractoreslinkcategoryscat913462tractoresishighlightlinkfalselabelorilladoras4
infantillinklandingcat400014seguridad-infantilishighlightlinkfalselabelseguridad4
vajillaslinkcategorycat4850316juegos-de-loza-y-vajillasishighlightlinkfalselabelcubiertoslinkcategoryscat317784cubiertosishighlightlinkfalselabelvasos4
reducidalinkcategoryscat922150seguridad-bano-y-movilidad-reducidaishighlightlinkfalselabelseguridad4
industriallinkcategorycat3230002aseo-industrialishighlightlinkfalselabelaerosoles4
autoslinkcategoryscat934755seguridad-para-autosishighlightlinkfalselabelcajas4
fuerteslinkcategoryscat874882cajas-fuertesishighlightlinkfalselabelseguridad4
viallinkcategoryscat348855seguridad-vialishighlightlinkfalselabelcandadoslinkcategoryscat933827candadosishighlightlinkfalselabelcadenas4
bolsaslinkcategorycat220008basureros-contenedores-y-bolsasishighlightlinkfalselabeldetergentes4
limpiadoreslinkcategorycat4850177detergentes-y-limpiadoresishighlightlinkfalselabelutensilios4
mesalinklandingcat10890003menaje-mesaleafcategorieslabeljuegos4
copaslinkcategorycat2960011vasos-y-copasishighlightlinkfalselabeldispensadores4
construccin4
compactadoraslinkcategorycat1060014placas-compactadorasishighlightlinkfalselabelcarretillas4
mucho4
windowdigitaldata4
constructorlinklandingscat913783maquinarias-y-herramientas-constructorleafcategorieslabelbetoneras4
tromposlinkcategoryscat100035betoneras-y-tromposishighlightlinkfalselabelrotomartillos4
demoledoreslinkcategorycat1080069rotomartillos-y-demoledoresishighlightlinkfalselabelsondas4
motriceslinkcategorycat1060016sondas-vibradoras-y-unidades-motricesishighlightlinkfalselabelplacas4
ruedaslinkcategoryscat913779carretillas-y-ruedasishighlightlinkfalselabeltecles4
perimetrallinklandingcat4850499seguridad-hogar-oficina-y-perimetralishighlightlinkfalselabelcontrol4
huincheslinkcategorycat710296tecles-y-huinchesishighlightlinkfalselabelchuzoslinkcategoryscat100013chuzosishighlightlinkfalselabelcortadoras4
mesalinkcategorycat4850026complementos-de-mesaishighlightlinkfalselabelbar4
pavimentolinkcategorycat4850151cortadoras-de-pavimentoishighlightlinkfalselabelpalas4
rastrilloslinkcategoryscat100012palas-picotas-y-rastrillosishighlightlinkfalselabelplatachos4
jarraslinkcategoryscat317806dispensadores-de-vidrio-y-jarrasishighlightlinkfalselabelcomplementos4
linklandingscat913800seguridadleafcategorieslabelelementos4
linklandingscat913754elementos-de-proteccion-personalishighlightlinkfalselabelseguridad4
mesalinkcategorycat920058textil-mesaishighlightlinkfalselabelmenaje4
telefnica4
44
menaje4
54
pinturas4
living4
iluminacin4
comerciales4
quinchos3
lavaplatos3
acondicionado3
bordado3
higiene3
cocinamenaje3
formones3
asientos3
prensas3
caimanes3
corte3
niveles3
nivelacin3
reglas3
robot3
cerraduras3
electrohogar3
sillas3
percheros3
plsticos3
canastos3
organizadoras3
cajas3
bancos3
sillones3
maletas3
laterales3
centro3
banquetas3
63
73
alarmas3
medicin3
portones3
multipropsito3
placas3
fijaciones3
elctricos3
timers3
obligaciones3
tableros3
alambres3
verde3
las3
hardboard3
humedad3
bloques3
acero3
easemedia3
segoe3
ui3
tabiquera3
yeso3
colgantes3
porcelanatos3
montaje3
contacto3
vinlicos3
alfombras3
piedras3
esta3
soluciones3
purificadores3
queremos3
barnices3
revestimientos3
vlvulas3
sobre3
nuestros3
tubos3
goma3
empotrados3
maestro3
garanta3
soporte3
kit3
rejas3
sistema3
monitoreo3
cmaras3
elsticas3
cermica3
flotantes3
neumticas3
mecnicas3
manuales3
equipamiento3
repuestos3
eslingas3
papel3
hormign3
inversores3
aislante3
piscinas3
prgolas3
campanas3
columnas3
lnea3
mamparas3
casetas3
trmico3
vitrificado3
calefaccin3
malla3
calefactores3
ventiladores3
solares3
escala3
ventanas3
cmr3
cargadores3
portamaceteros3
juguetes3
fuelle3
chinas3
planchas3
portables3
new3
inflables3
playa3
rascadores3
bsquetbol3
arena3
comederos3
casas3
ropa3
collares3
adoquines3
semillas3
pong3
bases3
aspirado3
retroceso3
utensilios3
vidrios3
tvespejostelevisores3
ledlavanderaporcelanatososbwc3
sanitariospolicarbonato3
neumticos3
pulido3
mejor3
spa3
amplificadores3
antenas3
antigolpes3
barras3
autos3
rueda3
hot3
cubrevolantes3

Who hosts Sodimac.cl?

Sodimac.cl Hosting Provider Information

Hosted IP Address:104.16.38.43
Hosted Hostname:104.16.38.43
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
CloudFlare, Inc.
1.5273%

HTTP Header Analysis for Sodimac.cl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 14 Oct 2020 07:07:03 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Wed, 14 Oct 2020 08:07:03 GMT
Location: https://www.sodimac.cl/sodimac-cl/
cf-request-id: 05c788216c0000002afb2e0200000001
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5e1f76157f13002a-LHR

Sodimac.cl Domain Nameserver Information

HostIP AddressCountry
zeus.ns.cloudflare.com 173.245.59.249
zeus.ns.cloudflare.com 173.245.59.249
rafe.ns.cloudflare.com 173.245.58.216
rafe.ns.cloudflare.com 173.245.58.216


Need to find out who hosts Sodimac.cl?


Domain Registration (WhoIs) information for Sodimac.cl

 %%
%% This is the NIC Chile Whois server (whois.nic.cl).
%%
%% Rights restricted by copyright.
%% See https://www.nic.cl/normativa/politica-publicacion-de-datos-cl.pdf
%%

Domain name: sodimac.cl
Registrant name: Sodimac S.A. Rep. por Silva & Cía.
Registrant organisation:
Registrar name: NIC Chile
Registrar URL: https://www.nic.cl
Creation date: 2005-06-07 20:52:55 CLST
Expiration date: 2023-07-03 16:52:05 CLST
Name server: rafe.ns.cloudflare.com
Name server: zeus.ns.cloudflare.com

%%
%% For communication with domain contacts please use website.
%% See https://www.nic.cl/registry/Whois.do?d=sodimac.cl
%%

Websites with Similar Names

Sodim.com
Home - Sodim - Hauni GmbH
Sodima.org
sodima.org
Sodimac-boutique.fr
SODIMAC Boutique - sodimac-boutique.fr
Sodimac.cl
Sodimac.cl | Todo en Hogar y Construcción
Sodimac.com
HOME REGIONAL | SODIMAC
Sodimac.com.ar
Sodimac.com.ar Tienda Online - Decoración, muebles, herramientas y materiales de construcción
Sodimac.com.co
Homecenter – Decoración, Muebles, Electrodomésticos, Herramientas y Construcción
Sodimac.com.pe
Sodimac.com.pe | Muebles, decoración, herramientas y construcción

Recently Updated Websites

Dark-side.info (2 seconds ago.)Trippingatwork.com (2 seconds ago.)Sunriseoffice.net (4 seconds ago.)Yesflex.com.br (5 seconds ago.)Jessholtonrealty.com (6 seconds ago.)Arai7.com (6 seconds ago.)Commealice.com (7 seconds ago.)Trackcovidprogression.com (8 seconds ago.)Sextactic.com (9 seconds ago.)Joffefederaldefense.com (9 seconds ago.)Sdxdcjw.com (9 seconds ago.)Hugowolfgang.com (11 seconds ago.)Bestgearperiod.com (11 seconds ago.)Teme.info (11 seconds ago.)Southflrealtygroup.com (12 seconds ago.)Ventit.world (12 seconds ago.)7830dt.com (13 seconds ago.)Jeffgreerky.com (13 seconds ago.)Aythj.com (13 seconds ago.)Trustedhomelending.com (14 seconds ago.)325675.com (14 seconds ago.)Quakeprep.net (14 seconds ago.)Publicso.com (14 seconds ago.)Bi9511.com (15 seconds ago.)Bstbuyer.com (15 seconds ago.)Globalartreach.net (15 seconds ago.)Elitehoustoncompanion.com (15 seconds ago.)Millermagick.com (16 seconds ago.)Bicoastalmortgage.com (17 seconds ago.)Canteen-wireless.com (17 seconds ago.)

Recently Searched Keywords

billiards lubbock (1 second ago.)sadharon gyan boi (2 seconds ago.)ellen says she (3 seconds ago.)backgroundff5065 (5 seconds ago.)14px height 14px (7 seconds ago.)radijojo schneit es bei euch gerade (9 seconds ago.)modalidades (11 seconds ago.)fortnite codes parkour (12 seconds ago.)entries feed (13 seconds ago.)情報発信 (13 seconds ago.)dustin diamond (13 seconds ago.)مواصفات وأسعار هاتف realme 6 (15 seconds ago.)фарҳанг вк ҷомеа (16 seconds ago.)сильнейший герой, обученный в тайном подземелье!  (16 seconds ago.)link ai (18 seconds ago.)bardzo dobrze dostatecznie siemion (19 seconds ago.)›promote (20 seconds ago.)львов - валютный аукцион (21 seconds ago.)chả mực bá kiến được làm từ những con mực tươi ngon từ vùng biển vịnh hạ long có chất lượng mực ngon nhất biển của việt nam (25 seconds ago.)radhika apte nude (26 seconds ago.)mrecht (27 seconds ago.)eccnet-uk (27 seconds ago.)slot 2 (29 seconds ago.)equity shares (30 seconds ago.)levy salis (31 seconds ago.)����Ƶ (31 seconds ago.)the current state of the us gambling laws (31 seconds ago.)grip-on (32 seconds ago.)fuel systems (32 seconds ago.)campaign 2020 live (33 seconds ago.)