Somersschools.org Favicon Somersschools.org

Somersschools.org Website Thumbnail
Checking...
Somers Central School District / Homepage
Low trust score
 | 
Add a review Change category Claim this site

Domain summary

Domain label
somersschools
Domain extension
org
Domain registered:
2006-09-11
Domain updated:
2020-08-12
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is somersschools.org ranked relative to other sites:

Percentage of visits to somersschools.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Somersschools.org registered?
A: Somersschools.org was registered 14 years, 2 weeks, 2 days, 3 hours, 22 minutes, 39 seconds ago on Monday, September 11, 2006.
Q: When was the WHOIS for Somersschools.org last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 1 day, 3 hours, 22 minutes, 39 seconds ago on Wednesday, August 12, 2020.
Q: What are Somersschools.org's nameservers?
A: DNS for Somersschools.org is provided by the following nameservers:
  • ns59.worldnic.com
  • ns60.worldnic.com
Q: Who is the registrar for the Somersschools.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Somersschools.org?
A: Somersschools.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Somersschools.org each day?
A: Somersschools.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Somersschools.org resolve to?
A: Somersschools.org resolves to the IPv4 address 52.206.191.232.
Q: In what country are Somersschools.org servers located in?
A: Somersschools.org has servers located in the United States.
Q: What webserver software does Somersschools.org use?
A: Somersschools.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Somersschools.org?
A: Somersschools.org is hosted by Amazon.com, Inc. in Virginia, Ashburn, United States, 20149.
Q: How much is Somersschools.org worth?
A: Somersschools.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Somersschools.org?

Somersschools.org Hosting Provider Information

Hosted IP Address:52.206.191.232
Hosted Hostname:ec2-52-206-191-232.compute-1.amazonaws.com
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:Microsoft-IIS/8.5

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Somersschools.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 12 Aug 2020 10:13:22 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: private
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
Strict-Transport-Security: max-age=31536000; includeSubDomains;
X-XSS-Protection: 1; mode=block
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Frame-Options: SAMEORIGIN

Somersschools.org Domain Nameserver Information

HostIP AddressCountry
ns59.worldnic.com 207.204.40.130
ns60.worldnic.com 207.204.21.130


Need to find out who hosts Somersschools.org?


WhoIs information for Somersschools.org

 Domain Name: SOMERSSCHOOLS.ORG
Registry Domain ID: D132552024-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2019-10-11T15:05:57Z
Creation Date: 2006-11-09T13:32:54Z
Registry Expiry Date: 2020-11-09T13:32:54Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS59.WORLDNIC.COM
Name Server: NS60.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-04-07T17:41:35Z

Somersschools.org Free SEO Report

Website Inpage Analysis for Somersschools.org

H1 Headings

21 :
  1. Announcements
  2. COVID-19 CORONAVIRUS INFORMATION AND RESOURCES
  3. Somers High School Blurred Lines Fashion Lookbook 2020
  4. Somers Central School District Virtual Art Gallery 2020
  5. New Evening Offering: Recognizing and Relieving Stress While at Home
  6. Opt out of video conferencing agreement for synchronized support sessions
  7. A Video Message from Dr. Blanch
  8. Distance Learning Q&A - Update April 14, 2020
  9. Distance Learning Q&A - April 1, 2020
  10. Meal Plan During the Coronavirus Pandemic
  11. Emergency Child Care for Healthcare Professionals and First Responders
  12. COVID-19 Distance Learning Technology Resources
  13. Free Wi-Fi from Optimum for 60 Days
  14. Upcoming Events
  15. August 25, 2020
  16. Quick Links
  17. Headlines & Features
  18. SING!
  19. Virtual Festival of the Arts
  20. Experimenting from Home
  21. Harmony from Home

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

19 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-121109275-1

Links - Internal

121:
  1. District Home
    https://www.somersschools.org/Domain/4
  2. Somers High School
    http://somersschools.org/Domain/8
  3. Somers Middle School
    http://somersschools.org/Domain/9
  4. Somers Intermediate School
    http://somersschools.org/Domain/10
  5. Primrose Elementary School
    http://somersschools.org/Domain/11
  6. Sign In
    https://www.somersschools.org/site/Default.aspx?PageType=7&SiteID=4&IgnoreRedirect=true
  7. Home
    http://somersschools.org/Page/1
  8. Our District
    http://somersschools.org/domain/1167
  9. Calendar
    http://somersschools.org/site/Default.aspx?PageID=2
  10. News Headlines - Delete?
    http://somersschools.org/domain/1173
  11. District Announcements - Delete?
    http://somersschools.org/domain/1174
  12. Upcoming Events - Delete?
    http://somersschools.org/domain/1175
  13. About Us
    http://somersschools.org/domain/1167
  14. Board of Education
    http://somersschools.org/domain/1168
  15. Committees
    http://somersschools.org/domain/1845
  16. District Departments
    http://somersschools.org/domain/1169
  17. Staff Directory
    http://somersschools.org/domain/1171
  18. At-A-Glance Key Contacts
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/1167/SCSD Key Contacts-Website.pdf
  19. Academics
    http://somersschools.org/domain/1157
  20. Student & Professional Learning
    http://somersschools.org/domain/24
  21. Whole Child Success Team
    http://somersschools.org/domain/799
  22. Academics Overview
    http://somersschools.org/domain/1157
  23. Primrose Elementary School (K-2)
    https://www.somersschools.org/Domain/11
  24. Somers Intermediate School (3-5)
    https://www.somersschools.org/Domain/10
  25. Somers Middle School
    https://www.somersschools.org/Domain/9
  26. Somers High School
    https://www.somersschools.org/Domain/8
  27. Families
    http://somersschools.org/domain/1726
  28. SEPTA
    https://www.somersschools.org/domain/1186
  29. Statement from K-12 Arts Department
    https://www.somersschools.org/Page/11295
  30. Welcome
    http://somersschools.org/domain/1726
  31. Digital Learning Guide for Families
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/1815/SCSD Distance Learning Parent Guide 3.17.20.pdf
  32. Technology Resources
    http://somersschools.org/domain/1817
  33. Booster
    https://www.somersschools.org/Page/8200
  34. Meal Planning
    http://somersschools.org/domain/1718
  35. New Family Registration
    https://www.somersschools.org/domain/1182
  36. Parents' Bill of Rights for Data Privacy & Security
    http://somersschools.org/domain/1841
  37. PTA
    http://somersschools.org/domain/1183
  38. Science Research Foundation
    http://somersschools.org/domain/1185
  39. Somers Tuskers Arts Rising Stars (STARS)
    http://somersschools.org/domain/1187
  40. TEAM Tuskers - Mentoring
    https://www.somersschools.org/site/Default.aspx?PageID=3966
  41. Video Library
    http://somersschools.org/site/Default.aspx?PageID=10978
  42. VIPS (Volunteers in Public Schools)
    http://somersschools.org/site/Default.aspx?PageID=12240
  43. Students
    http://somersschools.org/domain/1727
  44. Code of Conduct
    https://www.somersschools.org/Page/8994
  45. Welcome
    http://somersschools.org/domain/1727
  46. My School Bucks
    http://somersschools.org/domain/1407
  47. Middle School Sports
    https://www.somersschools.org/site/Default.aspx?PageID=3707
  48. High School Sports
    https://www.somersschools.org/site/Default.aspx?PageID=8179
  49. Community
    http://somersschools.org/domain/1728
  50. Facility Rental
    http://somersschools.org/domain/1193
  51. SEF
    http://somersschools.org/domain/1195
  52. SYSO
    http://somersschools.org/domain/1196
  53. Welcome
    http://somersschools.org/domain/1728
  54. COVID-19
    http://somersschools.org/domain/1815
  55. Budget Information
    http://somersschools.org/domain/1191
  56. Local Live Events!
    http://somersschools.org/domain/1804
  57. Tusker Nation Newsletter
    http://somersschools.org/domain/1603
  58. Tusker Talk Podcast
    http://somersschools.org/domain/1714
  59. TuskerTube Videos
    http://somersschools.org/domain/1805
  60. Channel 18
    http://somersschools.org/domain/1192
  61. FOIL (Freedom of Information Request)
    http://somersschools.org/domain/1194
  62. Safety & Security
    https://www.somersschools.org/Page/11218
  63. VIPS (Volunteers in Public Schools)
    http://somersschools.org/domain/1808
  64. DO NOT EDIT BELOW THIS POINT
    http://somersschools.org/domain/1478
  65. * BOE
    http://somersschools.org/domain/31
  66. * Schools
    http://somersschools.org/domain/1093
  67. * Community / Parents
    http://somersschools.org/domain/78
  68. * District Departments
    http://somersschools.org/domain/1129
  69. Annual Notification
    http://somersschools.org/domain/1129
  70. * Athletics
    http://somersschools.org/domain/788
  71. Sandbox
    http://somersschools.org/domain/141
  72. iTech
    http://somersschools.org/domain/750
  73. * Training
    http://somersschools.org/domain/143
  74. * Classroom 2.0
    http://somersschools.org/domain/148
  75. * TuskerTube
    http://somersschools.org/domain/149
  76. * Visual & Performing Arts
    http://somersschools.org/domain/792
  77. Subscribe to RSS Feed - Announcements
    https://www.somersschools.org/site/Default.aspx?PageType=4&DomainID=4&ModuleInstanceID=4&PageID=1
  78. COVID-19 CORONAVIRUS INFORMATION AND RESOURCES
    https://www.somersschools.org/domain/1815
  79. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25621&PageID=1&Comments=true
  80. Somers High School Blurred Lines Fashion Lookbook 2020
    https://www.somersschools.org/site/default.aspx?PageType=3&ModuleInstanceID=40090&ViewID=94B66785-F3F0-41A8-8414-1E55691D3E9E&RenderLoc=0&FlexDataID=26168&PageID=12617
  81. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26169&PageID=1&Comments=true
  82. Somers Central School District Virtual Art Gallery 2020
    https://www.somersschools.org/Page/12560
  83. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26052&PageID=1&Comments=true
  84. New Evening Offering: Recognizing and Relieving Stress While at Home
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26031&PageID=1
  85. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26031&PageID=1&Comments=true
  86. Opt out of video conferencing agreement for synchronized support sessions
    http://somersschools.org/cms/lib/NY01913963/Centricity/ModuleInstance/38329/Video Conferencing Opt Out.pdf
  87. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26020&PageID=1&Comments=true
  88. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25977&PageID=1&Comments=true
  89. Distance Learning Q&A - Update April 14, 2020
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25924&PageID=1
  90. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25924&PageID=1&Comments=true
  91. Distance Learning Q&A - April 1, 2020
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25879&PageID=1
  92. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25879&PageID=1&Comments=true
  93. Meal Plan During the Coronavirus Pandemic
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25834&PageID=1
  94. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25834&PageID=1&Comments=true
  95. Emergency Child Care for Healthcare Professionals and First Responders
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25833&PageID=1
  96. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25833&PageID=1&Comments=true
  97. COVID-19 Distance Learning Technology Resources
    https://www.somersschools.org/Page/12330
  98. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25705&PageID=1&Comments=true
  99. Free Wi-Fi from Optimum for 60 Days
    http://somersschools.org/cms/lib/NY01913963/Centricity/ModuleInstance/38329/Covid Internet Access.pdf
  100. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=38329&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=25835&PageID=1&Comments=true
  101. Board of Ed Mtg
    https://www.somersschools.org/site/Default.aspx?PageID=2&DomainID=4#calendar1/20200825/event/12340
  102. View Calendar
    http://somersschools.org/Page/2
  103. COVID-19 UPDATES/INFORMATION
    https://www.somersschools.org/domain/1815
  104. 2020-21 SCHOOL DISTRICT BUDGET
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/1191/2020-21%20Public%20Budget%20Document%20-%20Part%201%20and%202.pdf
  105. 2020-21 SCHOOL CALENDAR
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/4/SCSD Calendar 2020-21 Adopted Jan 28 2020.pdf
  106. 2019-20 SCHOOL DISTRICT BUDGET
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/4/2019-2020 Proposed Annual School Budget.pdf
  107. 2018-19 SCHOOL DISTRICT BUDGET
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/4/18 0515 Binder- Budget 2018-2019 Parts 1 and 2.pdf
  108. Annual Notifications
    http://somersschools.org/Page/7036
  109. Technology Links
    https://www.somersschools.org/Page/8512
  110. Parents' Bill of Rights for Data Privacy & Security
    https://www.somersschools.org/cms/lib/NY01913963/Centricity/Domain/1841/Parents Bill of Rights - May 2020.pdf
  111. Board Policies
    https://www.somersschools.org/Page/8995
  112. SING!
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26094&PageID=1
  113. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26094&PageID=1&Comments=true
  114. Virtual Festival of the Arts
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26081&PageID=1
  115. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26081&PageID=1&Comments=true
  116. Experimenting from Home
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26080&PageID=1
  117. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26080&PageID=1&Comments=true
  118. Harmony from Home
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26077&PageID=1
  119. Comments (-1)
    http://somersschools.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=34678&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=26077&PageID=1&Comments=true
  120. Site Map
    http://somersschools.org/site/Default.aspx?PageType=15&SiteID=4&SectionMax=15&DirectoryType=6
  121. DISCLAIMER
    http://somersschools.org/disclaimer

Links - Internal (nofollow)

0:

Links - Outbound

11:
  1. ANONYMOUS ALERTS
    https://anonymousalerts.com/somerscsd/default.aspx
  2. Anonymous Alerts
    https://anonymousalerts.com/somerscsd/default.aspx
  3. Somers Education Foundation (SEF)
    http://www.sefny.org/
  4. YMCA
    http://www.ymca.net/
  5. A Video Message from Dr. Blanch
    https://vimeo.com/410737924
  6. Anonymous Alerts
    http://anonymousalerts.com/somerscsd/
  7. NYS Office of Children and Family Services
    http://ocfs.ny.gov/main/cps/
  8. No text
    http://www.schoolwires.com/
  9. Blackboard Web Community Manager Privacy Policy (Updated)
    https://www.blackboard.com/blackboard-web-community-manager-privacy-statement
  10. Terms of Use
    https://help.blackboard.com/Terms_of_Use
  11. No text
    http://www.blackboard.com

Links - Outbound (nofollow)

0:

Keyword Cloud for Somersschools.org

activeselectorid aattrhrefcloseeventdateidflexdataid groupyear groupyear9groupbyfield groupbychksidebar function loadtaggeddatacontainer5openpagesubmenuthisparentset4 var pageidraisedbydatepickerdialog uidialogoverlayclosemodalvisiblelastclick elsemodulecontent miidalertboxid noclick elsetrueattrariaexpanded false0 varif ekeycode 27alertboxidestopimmediatepropagation epreventdefault closelidatabcsidpmi groupyeargroupby renderloc0fromrenderloc0enablequirksmode0tagvar data vardialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontentraisedbydatepicker estopimmediatepropagation epreventdefaultartsepreventdefault closeuiswalertattrid click oke var swalertopentag viewid targetviewetargetblurdialogoverlaywindowlargemodalbodymoderatecontentlength8documentreadyfunctiondistrictmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustachehidden detail viewgroupby targetview taggetcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceiduiswalertlength if swalertopentag iftargetviewview targetview hidmiiddetailviewvalview targetviewrenderloc0fromrenderloc0tagraisedbydatepicker etargetclasslistcontainsdatepickerrenderloc0fromrenderloc0enablequirksmode0tag tagsitenavulheightifewhich 13 thisclicktaglist li akeypressfunctionemodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionviewid targetview containerpagemoduleinstanceid pmimainhiddenesc was pressedtrimsublisthtml sublistattrariahidden trueattrariaexpandedget idthisclick function loadgroupeddatacontainerdoesnt bleed throughgetcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceidcontent doesnttargetview container 2if swalertopen 1pagemoduleinstanceidenablequirksmode0viewid viewtouse taguiswalert functionfunction e vardatepicker var raisedbydatepickertrue falsepagenavigationstatecookieparentzindexrenderloc0fromrenderloc0groupyearcalendaropen alert vartargetview containerimagetargetview hidmiiddetailviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidelse alertboxid noclickmiddle schoolpmiakeypressfunctione ifewhich 13push the recordrenderloc 0if ekeycodeuidialogoverlayclosemodalvisiblelastclick else removeloaddatacontainer miidetargetclasslistcontainsdatepickergroupbyfield groupby enablequirksmode0viewidelse removedocumentonclickifhidmiidsidebarlistviewlengthrenderloc0fromrenderloc0enablequirksmode0tag tag viewidschool district budgetmiid pmi tagloadgroupeddatacontainer miid pmiuserregiduidialogoverlay13 thisclick functionnoclick elseuiswalertepreventdefault check ifpmi tagcreateepreventdefault getgroupmonth groupmonthblanchrenderlocmiid pmitag iftargetview undefinedrenderloc0fromrenderloc0groupyear groupyearprimrosegroupmonth groupbyfielddata successappdata37185pushrecorddata37185 createrecordremovetrimsublisthtmltargetviewlength 0escape key estopimmediatepropagationloadgroupeddatacontainerokdivswspecialmodebarthisremoveclasshover var sublistswchanneldropdownhideifewhichuidialogoverlayclosemodalvisiblelastclickdoesntviewtouseif raisedbydatepicker estopimmediatepropagationactiveselectoridtaglist lidocumentonmouseoutmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsptargetview tag iftargetview2callcontrollerfailureresult0errormessageif alertboxidsidebarlistviewvalalert var alertboxidmiid pagemoduleinstanceidhigh schooladded to checkiftargetview undefinedrenderloc 0 varmake suresidebarlistviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidnavs activeselectoridekeycode 273hidden sidebar listdrkey estopimmediatepropagationimage of somersdomainid 4main data arrayfalse falsegetcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid4 varloaddatacontainertargetviewlengthfindtabindexfirstfocus 200moderatedvar swalertopen uiswalertlengthpressed on datepickerkeyetargetclasslistremovefocusbuilder viewvar renderlocviewtouse tag tagelementary schoolsure moderated contentthischildrenulclose dialogfunction loadgroupeddatacontainersettimeoutfunction modulecontent miidrenderloc0fromrenderloc0groupyear groupyear groupmonthtargetviewlength 0 targetviewdatepickermiid sidebarlistviewvalschoolthisremoveclasshover varflexdataidfunction loadgroupeddatacontainer miid2 chksidebardata array appdata37185pushrecorddata37185openundefinedactive classlist view definedremove focus etargetblurvar datableed throughiftargetview undefined targetviewlengthfocus etargetblur etargetclasslistremovefocuscontent doesnt bleedtag containersomers middlecontenthomeno ifcontainerhidmiiddetailviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidbodyonkeydowndata var successtargetview hidmiiddetailviewvalvar domainid 4miidfinduiwidgetdetailfinduiarticleappendnbspalertboxid okclickfunction epmi flexdataid flexdataidschool studentschevronmoderated content doesntrenderloc0fromrenderloc0tag tagaattrhrefgroupyear groupyeargroupyearmodulecontent miid findtabindexfirstfocushid miidcreate the recordiseditpmi flexdataid groupyearviewtouse ifhidmiidsidebarlistviewlength0 viewtousehidden detailgroupyear groupmonth groupmonthvar renderloc 0tag tag container1 varepreventdefault close dialognavigationtrue true falsegroupby tagundefined targetviewlengthcomments 1else if0 modulecontentmiid pagemoduleinstanceid pmienablequirksmode0viewidviewtouse container 213 thisclickalertboxid oklength 0chksidebar functionopen alerteventif trimsublisthtmldatepicker varlooksepreventdefault get iddistance learningetargetclasslistcontainsdatepicker ifdoesnt bleedpageidthroughdialog uidialogoverlayclosemodalvisiblelastclickactiveselectorid aattrtargetif dialogoverlaywindowlargemodalbodymoderatecontentlength 0sublistelementaryno if alertboxidetargetblur etargetclasslistremovefocus documentreadyfunctionvar failureloadgroupeddatacontainer miidmake sure moderatedflexdataid flexdataidswalertopenaddoffcanvasmenuheightforsitenavartelse alertboxidpagemoduleinstanceid pmi flexdataidthischildrenul ifalertboxid okclick elsesublistattrariahiddenthischildrenul if trimsublisthtmlhighview var viewtousegroupby renderloc0fromrenderloc0enablequirksmode0tag tagdetailgroupmonth groupmonth groupbyfieldfailure callcontrollerfailureresult0errormessagebuttonproplinkhrefdocumentreadyfunction vardialogoverlaywindowlargemodalbodymoderatecontentlength 0groupby tag viewtousemenudividerdetail view defineduiswalertlength ifzindexviewtouse looksvar successchksidebar settimeoutfunctionvar failure callcontrollerfailureresult0errormessagerenderloc0fromrenderloc0enablequirksmode0tagpmi tag viewtouseekeycode 27 escapeli akeypressfunctionethrough the dialogif esclicollapsibleeachfunctionswgotosearchresultspageswsearchinputswalertopen 1 ifhidden sidebararray recorddata37185documentreadyfunction taglistvar raisedbydatepickerpmi renderloc0fromrenderloc0tagvar alertboxid uiswalertattridtag tagfalseuidialogoverlaybasemodallearningsuccess failurehidmiiddetailviewvalhidmiiddetailviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid0 viewtouse hididfunction loadtaggeddatacontainer miiduidialogoverlay uiswalertif alertboxid oklengthtag viewid27 escape keyarraycheck ifpmi renderloc0fromrenderloc0groupyear groupyearakeypressfunctionevideoschool districtvar domainidrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouselilistlidatabcsid activeselectoridactivegroupbyfield1 iffalse pushkey estopimmediatepropagation epreventdefaultgroupby enablequirksmode0viewid viewtousefocus etargetblursublistattrariahidden trueattrariaexpanded falsedistancethisclick functionsettimeoutfunction modulecontentpageid 1 varclose dialog uidialogoverlayclosemodalvisiblelastclickelsemiid sidebarlistviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionrecord arrayraisedbydatepicker estopimmediatepropagationcontainer 2 chksidebardocumentonmouseover0 targetviewtag enablequirksmode0viewidviewtouse0 alertboxid okclickekeycodeetrimsublisthtml sublistattrariahiddenfunctionviewtouse hid miidif dialogoverlaywindowlargemodalbodymoderatecontentlength1estopimmediatepropagation epreventdefaultpagemoduleinstanceid pmi renderloc0fromrenderloc0groupyearswchanneldropdownhide thisremoveclasshoverulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedvirtualsidebarlistviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidviewidvar swalertopendomainid 4 varchannel2 chksidebar settimeoutfunctionarray recorddata37185 imagearray appdata37185pushrecorddata37185epreventdefault checkviewid targetviewelse remove focusgroupbybuilder view varpmi renderloc0fromrenderloc0groupyeargroupmonthnoclicketargetclasslistcontainsdatepicker if raisedbydatepickersureview varalert vardetail viewswchanneldropdownhide thisremoveclasshover varuiswalertlengthmiid findtabindexfirstfocus2 chksidebar functioncheckscriptmoduleviewcheckscriptmustacheenablequirksmode0viewidviewtouse containerhrefoklengthtaglistgroupmonth groupbyfield groupbyfailureoklength 01 var renderlocnoclick else ifuidialogoverlayclosemodalvisiblelastclick elsesuperintendentbleedactivechannelnavtypethisclickvar viewtouse ifhidmiidsidebarlistviewlengthchksidebar settimeoutfunction modulecontentheightaattrtargetvar pageid 1enablequirksmode0viewidsettimeoutfunctionclickmiid findtabindexfirstfocus 200recorddata37185 imagearray appdata37185pushrecorddata37185 createflexdataid flexdataid groupyearmoderated contentgroupby enablequirksmode0viewidpagemoduleinstanceid pmi renderloc0fromrenderloc0tagchksidebarselectschoolulheight7tag viewtouse looksdefinedremove focuscheck if escbuilder view targetviewnavalertiftargetviewpmi groupyear groupmonthif swalertopenepreventdefaulttruetag container 2miid pmi flexdataidsomers highsublistattrariahidden trueattrariaexpandedgroupyear groupyear groupmonthhid miid sidebarlistviewvalfocusviewtouse tag0false false pushsidebar list viewokclickpmi flexdataidsure moderateddialograisedbydatepicker etargetclasslistcontainsdatepicker ifif trimsublisthtml sublistattrariahiddenenablequirksmode0viewid viewtouseifhidmiidsidebarlistviewlength 0 viewtousealertboxid oklengthgroupmonth groupby tag1 if ekeycodegetgroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tagthisremoveclasshoverrecord array recorddata37185chksidebar function loaddatacontainerdata vardialog if dialogoverlaywindowlargemodalbodymoderatecontentlength0 ifcovid19groupyear groupmonthgroupby targetviewviewtouse hidescapesidebarqasidebar listokclick else alertboxidmain datadocumentreadyfunction var domainidpageid 1targetview tagnavscheckestopimmediatepropagation epreventdefault checkfunction iffunction loaddatacontainerid of openfindtabindexfirstfocustagclassprimrose elementarybodyonkeydown uidialogoverlaybasemodal uidialogoverlayloadtaggeddatacontainerestopimmediatepropagationfunction loadtaggeddatacontainertrue trueetargetclasslistremovefocus documentreadyfunctioneventkeycodeloadtaggeddatacontainer miidblackboardwindowlocationvar viewtouseflexdataid groupyear groupmonthlist viewsublist thischildrenul ifbodyonkeydown uidialogoverlaybasemodalclick oksomersmiidifuiswalertattridvar sublist thischildrenuluiswalertattrid clicksomers high schooltargetviewtag viewtouseokclick elseesc0 alertboxidmakedata arraypagenavigationstatecookie functionuidialogoverlay uiswalert functionvar raisedbydatepicker etargetclasslistcontainsdatepickerdialog ifflexdataid groupyearmiid pmi groupyearifewhich 13sublist thischildrenulvar alertboxid27 escape0 var miidpushtrue false falsedocumentreadyfunction taglist liloaddatacontainer miid pmienablequirksmode0viewidviewtousenobudgetcontainer 2alertboxid noclickdistrict budgetli akeypressfunctione ifewhichtrueattrariaexpandedalreadyundefined targetviewlength 0middlesomers middle schoolviewtouse ifhidmiidsidebarlistviewlength 0appdata37185pushrecorddata37185subtargetview looksvar pageidpressed4swalertopen uiswalertlength ifok or noaddeddata success failureetargetblur etargetclasslistremovefocusprimrose elementary schoolswalertopen 1swalertopen uiswalertlengthhidvar miidlinksviewuluibreadcrumbsvaruidialogoverlaybasemodal uidialogoverlayallrecorddata37185alertboxid uiswalertattridschool somersestopimmediatepropagation epreventdefault getswinnerwrapheightpmi renderloc0fromrenderloc0tag taguiswalert function eescape keygroupmonth groupby targetviewif eventkeycodepagedataloadtaggeddatacontainer miid pmigroupyear groupmonth groupbyvar sublistscsdalertboxid uiswalertattrid clickdocumentreadyfunction checkscriptmoduleviewcheckscriptmustacheifhidmiidsidebarlistviewlength 0view definedsitebuilder0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbspgroupmonth groupbycommentsaddcheck to makeoklength 0 alertboxidmodulecontentakeypressfunctione ifewhichsectiondomainidstudentsuidialogoverlaybasemodal uidialogoverlay uiswalerte varsuccesselse if ekeycodefunction loaddatacontainer miidout6strcookietag enablequirksmode0viewidviewtouse container0 targetview looksif raisedbydatepicker

Longtail Keyword Density for Somersschools.org

KeywordsOccurences
if ekeycode 2720
ekeycode 27 escape20
27 escape key20
escape key estopimmediatepropagation20
key estopimmediatepropagation epreventdefault20
container 2 chksidebar12
miid pagemoduleinstanceid pmi12
getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceid12
epreventdefault get id10
function e var10
if alertboxid oklength10
no if alertboxid10
ok or no10
ui-sw-alertattrid click ok10
alertboxid ui-sw-alertattrid click10
var alertboxid ui-sw-alertattrid10
ui-dialog-overlay ui-sw-alert function10
ui-sw-alert function e10
e var swalertopen10
id of open10
alert var alertboxid10
var swalertopen ui-sw-alertlength10
if swalertopen 110
oklength 0 alertboxid10
swalertopen ui-sw-alertlength if10
estopimmediatepropagation epreventdefault get10
ui-sw-alertlength if swalertopen10
open alert var10
alertboxid oklength 010
alertboxid okclick else10
0 alertboxid okclick10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
focus etargetblur etargetclasslistremovefocus10
remove focus etargetblur10
else remove focus10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
epreventdefault close dialog10
estopimmediatepropagation epreventdefault close10
raisedbydatepicker estopimmediatepropagation epreventdefault10
if raisedbydatepicker estopimmediatepropagation10
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
swalertopen 1 if10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
datepicker var raisedbydatepicker10
pressed on datepicker10
esc was pressed10
check if esc10
epreventdefault check if10
estopimmediatepropagation epreventdefault check10
else if ekeycode10
noclick else if10
alertboxid noclick else10
else alertboxid noclick10
okclick else alertboxid10
1 if ekeycode10
etargetblur etargetclasslistremovefocus documentreadyfunction9
groupmonth groupmonth groupbyfield8
viewtouse ifhid-miid-sidebarlistviewlength 08
groupmonth groupbyfield groupby8
-sidebarlistviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid8
miid -sidebarlistviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid8
hid- miid -sidebarlistviewval8
viewtouse hid- miid8
0 viewtouse hid-8
ifhid-miid-sidebarlistviewlength 0 viewtouse8
var viewtouse ifhid-miid-sidebarlistviewlength8
groupyear groupmonth groupmonth8
view var viewtouse8
builder view var8
list view defined8
sidebar list view8
hidden sidebar list8
tag viewtouse looks8
groupyear groupmonth groupby8
2 chksidebar function8
main data array7
create the record6
array recorddata37185 image6
record array recorddata371856
true false false6
false false push6
push the record6
data array appdata37185pushrecorddata371856
array appdata37185pushrecorddata37185 create5
if trimsublisthtml sublistattraria-hidden5
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
sublistattraria-hidden trueattraria-expanded false5
groupyear groupyear groupmonth4
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag4
miid pmi tag4
groupby renderloc0fromrenderloc0enablequirksmode0tag tag4
renderloc0fromrenderloc0enablequirksmode0tag tag viewid4
tag viewid targetview4
viewid targetview container4
targetview container 24
chksidebar function loadtaggeddatacontainer4
function loadtaggeddatacontainer miid4
loadtaggeddatacontainer miid pmi4
flexdataid flexdataid groupyear4
pmi tag viewtouse4
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag4
pmi renderloc0fromrenderloc0tag tag4
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse4
tag enablequirksmode0viewidviewtouse container4
enablequirksmode0viewidviewtouse container 24
2 chksidebar settimeoutfunction4
chksidebar settimeoutfunction module-content-4
settimeoutfunction module-content- miid4
module-content- miid findtabindexfirstfocus4
miid findtabindexfirstfocus 2004
flexdataid groupyear groupyear4
flexdataid groupyear groupmonth4
pmi flexdataid flexdataid4
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp4
content doesnt bleed4
doesnt bleed through4
through the dialog4
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength4
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 04
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-4
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction4
sure moderated content4
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache4
image of somers4
true true false4
documentreadyfunction tag-list li4
tag-list li akeypressfunctione4
li akeypressfunctione ifewhich4
pagemoduleinstanceid pmi flexdataid4
moderated content doesnt4
make sure moderated4
13 thisclick function4
domainid 4 var4
somers high school4
var sublist thischildrenul4
sublist thischildrenul if4
thischildrenul if trimsublisthtml4
documentreadyfunction var domainid4
var domainid 44
4 var pageid4
check to make4
var pageid 14
pageid 1 var4
1 var renderloc4
var renderloc 04
renderloc 0 var4
0 var miid4
added to check4
ifewhich 13 thisclick4
akeypressfunctione ifewhich 134
thisclick function loadgroupeddatacontainer4
undefined targetviewlength 04
function loadgroupeddatacontainer miid4
groupmonth groupby targetview4
groupby targetview tag4
targetview tag iftargetview4
tag iftargetview undefined4
iftargetview undefined targetviewlength4
targetviewlength 0 targetview4
miid pmi flexdataid4
0 targetview looks4
hidden detail view4
detail view defined4
hid-miid-detailviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid4
builder view targetview4
view targetview hid-miid-detailviewval4
pmi flexdataid groupyear4
loaddatacontainer miid pmi4
function loaddatacontainer miid4
pmi renderloc0fromrenderloc0groupyear groupyear4
loadgroupeddatacontainer miid pmi4
miid pmi groupyear4
pmi groupyear groupmonth4
groupmonth groupby tag4
groupby tag viewtouse4
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear4
renderloc0fromrenderloc0groupyear groupyear groupmonth4
groupbyfield groupby enablequirksmode0viewid4
groupby enablequirksmode0viewid viewtouse4
enablequirksmode0viewid viewtouse tag4
viewtouse tag tag4
tag tag container4
tag container 24
chksidebar function loaddatacontainer4
targetview hid-miid-detailviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid4
somers middle school3
var failure callcontrollerfailureresult0errormessage3
data success failure3
data var success3
primrose elementary school3
sw-channel-dropdownhide thisremoveclasshover var3
thisremoveclasshover var sublist3
school district budget3
var data var3
estopimmediatepropagation epreventdefault30
if ekeycode23
key estopimmediatepropagation20
ekeycode 2720
27 escape20
escape key20
groupyear groupmonth16
comments -116
record array13
container 212
miid pmi12
getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid12
miid pagemoduleinstanceid12
pagemoduleinstanceid pmi12
view defined12
else if12
builder view12
2 chksidebar12
function e11
ui-dialog-overlay-closemodalvisiblelastclick else10
var alertboxid10
alert var10
open alert10
if raisedbydatepicker10
ui-dialog-overlay ui-sw-alert10
close dialog10
ui-sw-alert function10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
epreventdefault get10
remove focus10
else remove10
ui-sw-alertattrid click10
focus etargetblur10
etargetblur etargetclasslistremovefocus10
1 if10
swalertopen 110
if swalertopen10
ui-sw-alertlength if10
swalertopen ui-sw-alertlength10
var swalertopen10
e var10
alertboxid ui-sw-alertattrid10
get id10
click ok10
epreventdefault check10
etargetclasslistcontainsdatepicker if10
raisedbydatepicker etargetclasslistcontainsdatepicker10
var raisedbydatepicker10
bodyonkeydown ui-dialog-overlay-base-modal10
ui-dialog-overlay-base-modal ui-dialog-overlay10
datepicker var10
no if10
if esc10
check if10
alertboxid oklength10
raisedbydatepicker estopimmediatepropagation10
alertboxid okclick10
if alertboxid10
epreventdefault close10
oklength 010
noclick else10
0 alertboxid10
okclick else10
else alertboxid10
alertboxid noclick10
etargetclasslistremovefocus documentreadyfunction9
flexdataid groupyear8
view var8
var viewtouse8
viewtouse ifhid-miid-sidebarlistviewlength8
ifhid-miid-sidebarlistviewlength 08
0 viewtouse8
pmi flexdataid8
chksidebar function8
groupmonth groupmonth8
-sidebarlistviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid8
miid -sidebarlistviewval8
hid- miid8
groupbyfield groupby8
groupmonth groupbyfield8
viewtouse hid-8
false false8
list view8
hidden sidebar8
viewtouse looks8
tag viewtouse8
groupmonth groupby8
sidebar list8
main data7
data array7
recorddata37185 image6
array recorddata371856
false push6
true false6
if trimsublisthtml6
array appdata37185pushrecorddata371856
var sublist6
school district5
0 var5
trimsublisthtml sublistattraria-hidden5
documentreadyfunction var5
sublistattraria-hidden trueattraria-expanded5
trueattraria-expanded false5
if eventkeycode5
appdata37185pushrecorddata37185 create5
function loadtaggeddatacontainer4
tag enablequirksmode0viewidviewtouse4
targetview container4
loadtaggeddatacontainer miid4
pmi tag4
viewid targetview4
tag viewid4
pmi renderloc0fromrenderloc0tag4
renderloc0fromrenderloc0tag tag4
0 if4
enablequirksmode0viewidviewtouse container4
chksidebar settimeoutfunction4
settimeoutfunction module-content-4
module-content- miid4
miid findtabindexfirstfocus4
findtabindexfirstfocus 2004
groupby renderloc0fromrenderloc0enablequirksmode0tag4
function if4
activeselectorid aattrhref4
renderloc0fromrenderloc0enablequirksmode0tag tag4
tag container4
groupyear groupyear4
moderated content4
documentreadyfunction tag-list4
true true4
school students4
documentreadyfunction checkscriptmoduleviewcheckscriptmustache4
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction4
flexdataid flexdataid4
0 module-content-4
dialog-overlay-windowlargemodal-bodymoderatecontentlength 04
if dialog-overlay-windowlargemodal-bodymoderatecontentlength4
dialog if4
bleed through4
doesnt bleed4
content doesnt4
sure moderated4
li akeypressfunctione4
make sure4
var miid4
renderloc 04
var renderloc4
1 var4
pageid 14
var pageid4
4 var4
domainid 44
var domainid4
thischildrenul if4
sublist thischildrenul4
high school4
somers high4
tag-list li4
module-content- miidfindui-widget-detailfindui-articleappendnbsp4
akeypressfunctione ifewhich4
function loaddatacontainer4
hid-miid-detailviewval getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid4
targetview hid-miid-detailviewval4
view targetview4
detail view4
hidden detail4
targetview looks4
ifewhich 134
targetviewlength 04
undefined targetviewlength4
iftargetview undefined4
tag iftargetview4
targetview tag4
groupby targetview4
loaddatacontainer miid4
0 targetview4
tag tag4
viewtouse tag4
13 thisclick4
thisclick function4
enablequirksmode0viewid viewtouse4
groupby enablequirksmode0viewid4
renderloc0fromrenderloc0groupyear groupyear4
pmi renderloc0fromrenderloc0groupyear4
groupby tag4
pmi groupyear4
loadgroupeddatacontainer miid4
function loadgroupeddatacontainer4
data var3
var failure3
active class3
navs- activeselectorid3
var success3
lidata-bcsid activeselectorid3
data success3
activeselectorid aattrtarget3
pagenavigationstatecookie function3
failure callcontrollerfailureresult0errormessage3
primrose elementary3
success failure3
school somers3
somers middle3
middle school3
elementary school3
sw-channel-dropdownhide thisremoveclasshover3
thisremoveclasshover var3
district budget3
distance learning3
var data3
if121
var87
function63
047
alertboxid40
miid40
else39
estopimmediatepropagation30
epreventdefault30
documentreadyfunction29
tag28
viewtouse28
view26
false24
pmi24
groupmonth24
ekeycode23
122
221
key20
raisedbydatepicker20
school20
escape20
array20
swalertopen20
groupyear20
317
check16
comments16
targetview16
groupby16
open16
true16
set14
data14
somers14
dialog14
record13
activeselectorid13
close13
hidden13
remove12
412
container12
pagemoduleinstanceid12
documentonclick12
click12
getcontenthttpswwwsomersschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid12
builder12
flexdataid12
defined12
looks12
e12
chksidebar12
esc11
no11
li11
etargetblur10
etargetclasslistremovefocus10
students10
navigation10
focus10
id10
noclick10
alert10
get10
ui-sw-alertattrid10
ok10
ui-sw-alertlength10
oklength10
okclick10
ui-sw-alert10
ui-dialog-overlay10
ui-dialog-overlay-base-modal10
bodyonkeydown10
pressed10
datepicker10
etargetclasslistcontainsdatepicker10
ui-dialog-overlay-closemodalvisiblelastclick10
list9
undefined8
ifhid-miid-sidebarlistviewlength8
sidebar8
hid-8
-sidebarlistviewval8
page8
main8
groupbyfield8
module-content-8
eventkeycode7
57
home7
district7
recorddata371857
trimsublisthtml6
href6
sublistattraria-hidden6
failure6
success6
active6
channel6
content6
through6
create6
virtual6
swinnerwrapheight6
appdata37185pushrecorddata371856
push6
image6
sublist6
learning5
65
sw-channel-dropdownhide5
trueattraria-expanded5
isedit5
userregid5
75
make5
thisremoveclasshover4
thisclick4
domainid4
sub4
thischildrenul4
high4
windowlocation4
class4
section4
aattrhref4
navs-4
pagenavigationstatecookie4
84
documentonmouseover4
qa4
loadgroupeddatacontainer4
documentonmouseout4
doesnt4
hid-miid-detailviewval4
detail4
targetviewlength4
added4
iftargetview4
sure4
loaddatacontainer4
moderated4
bleed4
loadtaggeddatacontainer4
enablequirksmode0viewid4
renderloc0fromrenderloc0groupyear4
dialog-overlay-windowlargemodal-bodymoderatecontentlength4
miidfindui-widget-detailfindui-articleappendnbsp4
checkscriptmoduleviewcheckscriptmustache4
tag-list4
akeypressfunctione4
ifewhich4
viewid4
renderloc0fromrenderloc0enablequirksmode0tag4
renderloc0fromrenderloc0tag4
settimeoutfunction4
renderloc4
covid-194
94
findtabindexfirstfocus4
pageid4
enablequirksmode0viewidviewtouse4
menu3
eventdateid3
divsw-special-mode-bar3
links3
calendar3
lidata-bcsid3
aattrtarget3
ului-breadcrumbs3
arts3
strcookie3
superintendent3
budget3
art3
addoffcanvasmenuheightforsitenav3
sitenavulheight3
all3
distance3
selectschoolulheight3
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
blanch3
activechannelnavtype3
blackboard3
out3
callcontrollerfailureresult0errormessage3
site3
swgotosearchresultspageswsearchinput3
add3
elementary3
primrose3
middle3
dr3
already3
buttonproplinkhref3
scsd3
parentzindex3
event3
licollapsibleeachfunction3
height3
nav3
chevron3
zindex3
openpagesubmenuthisparent3
divider3
video3

Somersschools.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Somersschools.org is a scam?

Websites with Similar Names

Somer.dk
Steffen Somer – Just another WordPress site
Somer.hu
Database Error
Somera.com.tr
Home | Somera
Someracingshop.com
someracingshop.com - Registered at Namecheap.com
Someral.xyz
someral.xyz - Registered at Namecheap.com
Someralaw.com
VS Trial Lawyers - Injured? Contact us at Villapudua Somera today
Somerandemily.com
Somer Badra and Emily Xiong's Wedding Website
Somerandom15.net
somerandom15.net - Registered at Namecheap.com
Somerandombar.com
Home | Some Random Bar | Seattle, WA
Somerandomcompany.com
Error 404 (Not Found)!!1

Recently Updated Websites

Divanirossii.ru 2 seconds ago.Backstageticketvip.com 3 seconds ago.Benignocalvo.com 3 seconds ago.Pmiind.com 3 seconds ago.Palmbeachjewishfilm.org 3 seconds ago.Cometcleaner.com 4 seconds ago.Electromenager-compare.com 4 seconds ago.Baiduyunbt.com 5 seconds ago.Tupacquotes.com 5 seconds ago.Astralm.ru 6 seconds ago.Ripplefeed.com 6 seconds ago.Beautybyizzy.com 6 seconds ago.Smctheatre.com 6 seconds ago.Tommasopincio.net 6 seconds ago.Enlightenmentsaloon.net 7 seconds ago.Shsongxin.com 8 seconds ago.Lucystoppers.com 9 seconds ago.Expfabrication.net 9 seconds ago.Sandhillsthermalimaging.com 9 seconds ago.Clubclio.co.kr 10 seconds ago.Ardakemanci.com 11 seconds ago.Liveasianwebcammodels.com 11 seconds ago.Alternativedirectionsinc.org 11 seconds ago.Madelainehailey.com 12 seconds ago.Ourdfwhomevalue.com 12 seconds ago.Dagmaramaria.com 12 seconds ago.Texaszombie.com 12 seconds ago.Peterjanes.ca 12 seconds ago.East4.nl 12 seconds ago.Otemo-yan.net 12 seconds ago.