Sonsbeekmedia.nl

Website Thumbnail
Checking...
BasBrands.nl

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet

My Moodle Work in 2016 - 2017? Developing for Moodle in 2016 2017 Moodle continues to change and evolve just like most Open Source projects. In May …


Domain summary

Domain label
sonsbeekmedia
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is sonsbeekmedia.nl ranked relative to other sites:

Percentage of visits to sonsbeekmedia.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sonsbeekmedia.nl registered?
A: Sonsbeekmedia.nl was registered 1 month, 2 days, 8 hours, 53 minutes, 47 seconds ago on Friday, October 30, 2020.
Q: When was the WHOIS for Sonsbeekmedia.nl last updated?
A: The WHOIS entry was last updated 1 month, 2 days, 8 hours, 53 minutes, 47 seconds ago on Friday, October 30, 2020.
Q: What are Sonsbeekmedia.nl's nameservers?
A: DNS for Sonsbeekmedia.nl is provided by the following nameservers:
  • ns1.openprovider.nl
  • ns2.openprovider.be
  • ns3.openprovider.eu
Q: Who is the registrar for the Sonsbeekmedia.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Sonsbeekmedia.nl?
A: Sonsbeekmedia.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Sonsbeekmedia.nl each day?
A: Sonsbeekmedia.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Sonsbeekmedia.nl resolve to?
A: Sonsbeekmedia.nl resolves to the IPv4 address 178.79.155.254.
Q: In what country are Sonsbeekmedia.nl servers located in?
A: Sonsbeekmedia.nl has servers located in the United Kingdom.
Q: What webserver software does Sonsbeekmedia.nl use?
A: Sonsbeekmedia.nl is powered by Apache/2.4.25 (Debian) webserver.
Q: Who hosts Sonsbeekmedia.nl?
A: Sonsbeekmedia.nl is hosted by TELECITYGROUP INTERNATIONAL LIMITED in England, London, United Kingdom, Ec2v.
Q: How much is Sonsbeekmedia.nl worth?
A: Sonsbeekmedia.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Sonsbeekmedia.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sonsbeekmedia.nl Free SEO Report

Website Inpage Analysis for Sonsbeekmedia.nl

H1 Headings

1 :
  1. Bas Brands

H2 Headings

25 :
  1. Freelance web developer
  2. Developing for Moodle in 2016 2017
  3. The Boost theme for Moodle
  4. My top individual projects: Don’t Memorise
  5. My top collaboration projects: Arup
  6. My top design project: The Moodle academy theme
  7. My future projects.
  8. FOSDEM 2015
  9. The Fosdem User Experience
  10. Some Fosdem15 highlights
  11. Using Moodle as a video platform
  12. The Startprep project.
  13. Student feedback can allows teachers to increase the content quality.
  14. How the teacher manages comments.
  15. How it all works
  16. The results
  17. Presentation Moodlemoot UK
  18. Saint Patricks day Moodle theme.
  19. How this theme was build
  20. Theme Bootstrap 3 for Moodle
  21. So what is Twitter Bootstrap?
  22. Coding for fun
  23. Get it now!
  24. Get the new Google Analytics Moodle plugin
  25. download

H3 Headings

12 :
  1. Every Pixel hurts: Pablo Cúbico.
  2. Open UI5: DJ Adams
  3. Ultra: Steven Goodwin
  4. The Mozilla Devroom: Various speakers
  5. The Mars One mission: Ryan MacDonald
  6. The Moodle webvideo plugin
  7. A course containing webvideo resources
  8. Videos shown in a Bootstrap Modal
  9. The video search options
  10. Managing videos
  11. Conclusion
  12. Introduction

H4 Headings

14 :
  1. My Moodle Work in 2016 - 2017?
  2. FOSDEM 2015 Review
  3. Moodle as a Video Platform
  4. Allow Your Students to Add Feedback to Quiz Questions
  5. Making Moodle Multi Device Friendly With Bootstrap
  6. Saint Patricks Day Shamrock Moodle Theme
  7. Creating a Moodle Bootstrap 3 Theme
  8. Moodle Google Analytics
  9. Moodle Developer Meeting
  10. Building With Bootstrap
  11. Navigation
  12. About Bas Brands
  13. Recent Posts
  14. GitHub Repos

H5 Headings

2 :
  1. Contact Me
  2. About this blog

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-30991203-1

Links - Internal

30:
  1. Sonsbeekmedia Bas Brands
    http://sonsbeekmedia.nl/index.html
  2. Sonsbeekmedia My Moodle Work in 2016 - 2017?
    http://sonsbeekmedia.nl/blog/2017/03/28/Moodle-What-happended-in-2016-2017/
  3. Sonsbeekmedia FOSDEM 2015 Review
    http://sonsbeekmedia.nl/blog/2015/02/02/fosdem-15-review/
  4. Sonsbeekmedia Moodle as a Video Platform
    http://sonsbeekmedia.nl/blog/2015/01/26/moodle-as-a-video-platform/
  5. Sonsbeekmedia Moodle Bootstrap themes
    http://theming.sonsbeekmedia.nl
  6. Sonsbeekmedia Allow Your Students to Add Feedback to Quiz Questions
    http://sonsbeekmedia.nl/blog/2014/08/21/startprep-quizcomments/
  7. Sonsbeekmedia Making Moodle Multi Device Friendly With Bootstrap
    http://sonsbeekmedia.nl/blog/2014/04/16/Making-moodle-multi-device-friendly-with-bootstrap/
  8. Sonsbeekmedia Saint Patricks Day Shamrock Moodle Theme
    http://sonsbeekmedia.nl/blog/2014/03/16/Moodle-theme-shamrock/
  9. Sonsbeekmedia Creating a Moodle Bootstrap 3 Theme
    http://sonsbeekmedia.nl/blog/2014/01/05/creating-a-moodle-bootstrap3-theme/
  10. Sonsbeekmedia Sonsbeekmedia theming
    http://theming.sonsbeekmedia.nl
  11. Sonsbeekmedia Read on →
    http://sonsbeekmedia.nl/blog/2014/01/05/creating-a-moodle-bootstrap3-theme/
  12. Sonsbeekmedia Moodle Google Analytics
    http://sonsbeekmedia.nl/blog/2013/08/30/improved-moodle-google-analytics/
  13. Sonsbeekmedia Read on →
    http://sonsbeekmedia.nl/blog/2013/08/30/improved-moodle-google-analytics/
  14. Sonsbeekmedia Moodle Developer Meeting
    http://sonsbeekmedia.nl/blog/2013/07/30/moodle-developer-meeting/
  15. Sonsbeekmedia Read on →
    http://sonsbeekmedia.nl/blog/2013/07/30/moodle-developer-meeting/
  16. Sonsbeekmedia Building With Bootstrap
    http://sonsbeekmedia.nl/blog/2013/05/21/building-with-bootstrap/
  17. Sonsbeekmedia Read on →
    http://sonsbeekmedia.nl/blog/2013/05/21/building-with-bootstrap/
  18. Sonsbeekmedia ← Older
    http://sonsbeekmedia.nl/blog/page/2/
  19. Sonsbeekmedia Blog Archives
    http://sonsbeekmedia.nl/blog/archives
  20. Sonsbeekmedia My way of working
    http://sonsbeekmedia.nl/mywayofworking/
  21. Sonsbeekmedia Blog Posts
    http://sonsbeekmedia.nl/
  22. Sonsbeekmedia Moodle Theming
    http://theming.sonsbeekmedia.nl
  23. Sonsbeekmedia Archives
    http://sonsbeekmedia.nl/blog/archives
  24. Sonsbeekmedia RSS Feed
    http://sonsbeekmedia.nl/atom.xml
  25. Sonsbeekmedia My Moodle work in 2016 - 2017?
    http://sonsbeekmedia.nl/blog/2017/03/28/Moodle-What-happended-in-2016-2017/
  26. Sonsbeekmedia Moodle as a video platform
    http://sonsbeekmedia.nl/blog/2015/01/26/moodle-as-a-video-platform/
  27. Sonsbeekmedia Allow your students to add feedback to quiz questions
    http://sonsbeekmedia.nl/blog/2014/08/21/startprep-quizcomments/
  28. Sonsbeekmedia Making Moodle multi device friendly with bootstrap
    http://sonsbeekmedia.nl/blog/2014/04/16/Making-moodle-multi-device-friendly-with-bootstrap/
  29. Sonsbeekmedia Home
    http://sonsbeekmedia.nl/
  30. Sonsbeekmedia Moodle Bootstrap
    http://theming.sonsbeekmedia.nl

Links - Internal (nofollow)

0:

Links - Outbound

43:
  1. Sonsbeekmedia Bootstrap 4
    http://getbootstrap.com/
  2. Sonsbeekmedia Moustache templates
    https://docs.moodle.org/dev/Templates
  3. Sonsbeekmedia community version
    https://moodle.org/plugins/theme_bootstrap
  4. Sonsbeekmedia Don’t Memorise
    https://dontmemorise.com/
  5. Sonsbeekmedia Moodle academy
    http://academy.moodle.net
  6. Sonsbeekmedia Material design
    https://material.io/guidelines/
  7. Sonsbeekmedia Fosdem conference
    https://fosdem.org
  8. Sonsbeekmedia AFK
    http://www.urbandictionary.com/define.php?term=afk
  9. Sonsbeekmedia presentation link
    http://slidedeck.io/pablocubico/fosdem2015
  10. Sonsbeekmedia examples of openUI5
    https://openui5.hana.ondemand.com/
  11. Sonsbeekmedia Ultra
    http://marquisdegeek.com/code_ultra.php
  12. Sonsbeekmedia presentation link
    https://fosdem.org/2015/schedule/event/ultra_web_server/attachments/slides/584/export/events/attachments/ultra_web_server/slides/584/ultra_fosdem_2015d.pdf
  13. Sonsbeekmedia Mozilla.org
    http://mozilla.org
  14. Sonsbeekmedia video.fosdem.org
    http://video.fosdem.org/
  15. Sonsbeekmedia The Martian
    http://en.wikipedia.org/wiki/The_Martian_%28Weir_novel%29
  16. Sonsbeekmedia Don’t Memorise
    http://dontmemorise.com
  17. Sonsbeekmedia fullimage
    http://basbrands.nl/images/quizpage.png
  18. Sonsbeekmedia fullimage
    http://basbrands.nl/images/quizcomments.png
  19. Sonsbeekmedia fullimage
    http://basbrands.nl/images/presentation.png
  20. Sonsbeekmedia View presentation
    http://basbrands.nl/presentation
  21. Sonsbeekmedia David Scotson
    https://github.com/ds125v
  22. Sonsbeekmedia Joby Harding
    https://github.com/jobyh
  23. Sonsbeekmedia Gareth Barnard
    https://github.com/gjb2048
  24. Sonsbeekmedia Gavin Henrick
    http://www.somerandomthoughts.com
  25. Sonsbeekmedia fullimage
    http://basbrands.nl/images/theme_shamrock.png
  26. Sonsbeekmedia Download
    https://github.com/bmbrands/theme_bootstrap_bootswatches/blob/master/bootstrap3_shamrock-2014032100.zip?raw=true
  27. Sonsbeekmedia Thomas Park
    https://github.com/thomaspark
  28. Sonsbeekmedia Github
    https://github.com/bmbrands/theme_bootstrap
  29. Sonsbeekmedia download
    https://github.com/bmbrands/local_googleanalytics/archive/master.zip
  30. Sonsbeekmedia download from Github
    https://github.com/bmbrands/local_googleanalytics/archive/master.zip
  31. Sonsbeekmedia Moodle Developer meeting
    http://docs.moodle.org/dev/Developer_meeting_July_2013
  32. Sonsbeekmedia Moodle
    http://www.Moodle.org
  33. Sonsbeekmedia iMoot
    http://www.imoot.org
  34. Sonsbeekmedia LinkedIn
    http://www.linkedin.com/pub/bas-brands/16/404/319
  35. Sonsbeekmedia Twitter
    http://twitter.com/basbrands
  36. Sonsbeekmedia Google+
    https://plus.google.com/+BasBrands
  37. Sonsbeekmedia @bmbrands
    https://github.com/bmbrands
  38. Sonsbeekmedia Bas Brands
    http://nl.linkedin.com/pub/bas-brands/16/404/319/
  39. http://twitter.com/basbrands
    http://twitter.com/basbrands
  40. Sonsbeekmedia Octopress
    http://octopress.org/
  41. Sonsbeekmedia Brandon Mathis
    http://brandonmathis.com/
  42. Sonsbeekmedia Jekyll
    http://github.com/mojombo/jekyll
  43. Sonsbeekmedia Blog
    http://www.basbrands.nl

Links - Outbound (nofollow)

0:

Keyword Cloud for Sonsbeekmedia.nl

smallhadboostveryimplementingitsprojectskeepmozillafewwepatricks day3add somepowerdeviceclickstilllasteachdjusewellmakeifamhave beenyearsimpleadding2016 2017duringtheyparentstudentsanesthesiamakessitemy topeveryteachersoftwarebootstrap framework2013 readgetownmoodle multi deviceread on rarrwhichalreadyallothercalledattendeesdataboost themesaintanalyticstimequizwebdevelopingmycommentsit8217slearnmodulemeetinghasmaking moodlewebvideo pluginyoutubebecausetoolswithoutmoodle themecontentmostwebvideothememakingultrabutsimplyfosdem 2015openblogdeveloperwouldfreebeensystemcssallowsversionlikedevice friendlymarswebsitegoogleplatformsetconferencethat8217sgithubsaint patricksanymanynewgoogle analyticsfutureworkusingdesignedbecomesourcebasmars oneyoutheircoursesenjoyqualityfriendly with bootstrappostvideo8217steacherscooltheme calledyour studentsframeworkbuildfeaturesintopresentationlearningmediacleanrarrmemorise0writtenvideospostsprogresscommunitypluginsuserdaynew versiontrackdesignquestionversion 3bignothowevertheseshownhighhavejavascripthtmlchangeswaytalkspatricksprovideshamrockuser interfacesfriendlyneedinterfacesusersgreatadd feedbacktop6custommoodle multibetterdevelopershopeyearsuses524mobilecompanyusedbuildinghis1coremoodle bootstrap themeinterfacevideo platformlotscreatingworkinglargequestionsbootstrapbase themeonlinechangesessionbootswatchesmaking moodle multilinksaint patricks dayfuntalktheme for moodleyournowthemhas becometogethercreateworksbootstrap thememoodle bootstrapdooverdon8217toncesomemulti device friendlyuser interfacefeedback to quizideasourreleasedsome timefullimagekeepstherequiz moduledoesopen sourcedownloadvarfeedbackmorecodemissionfirefoxaddedbasedbootstrapbootstrap 3onemaincancouldeasyquitemulti devicedon8217t memorisebootstrapbasesearchsoexperiencemoodleplugintwitter bootstrapadddesignersjustcoffeestartprepmulticreatedcan8217tnicequiz questionssessionsprojectdoes notyou canvideodevelopmentbrandsreadstudents to addfosdemgoingbas brandscoursehas beentwitterquizzesthemesstudentdidgotabshareme

Longtail Keyword Density for Sonsbeekmedia.nl

KeywordsOccurences
read on rarr4
theme for moodle3
students to add3
feedback to quiz3
making moodle multi3
moodle multi device3
multi device friendly3
friendly with bootstrap3
saint patricks day3
moodle bootstrap theme3
open source12
moodle theme9
twitter bootstrap7
you can7
don8217t memorise7
google analytics7
has been6
user interface5
new version5
moodle bootstrap5
bas brands4
bootstrapbase theme4
bootstrap theme4
quiz module4
quiz questions4
webvideo plugin4
mars one4
boost theme4
user interfaces4
device friendly3
some time3
bootstrap framework3
theme called3
version 33
has become3
add some3
patricks day3
saint patricks3
multi device3
video platform3
moodle multi3
making moodle3
bootstrap 33
my top3
add feedback3
does not3
your students3
2016 20173
fosdem 20153
have been3
2013 read3
moodle81
theme51
bootstrap32
can27
have24
video21
you20
some19
my19
using18
open18
user17
new15
version14
work14
videos14
your14
one13
comments13
not13
all12
source12
quiz12
most12
has12
way12
course11
developers11
project11
based11
plugin10
more10
so10
don8217t10
learning10
but10
me10
module9
been9
build9
very9
there9
like8
add8
feedback8
google8
into8
now8
twitter8
their8
mars8
read7
many7
year7
memorise7
we7
create7
development7
fosdem7
search7
use7
boost7
design7
questions7
projects7
analytics7
06
creating6
working6
these6
presentation6
allows6
am6
platform6
interface6
site6
building6
framework6
each6
still6
features6
developer6
over6
they6
any6
teacher6
conference6
webvideo6
set6
it8217s6
great6
used6
other6
16
blog5
link5
progress5
25
day5
change5
content5
our5
mission5
get5
ultra5
easy5
users5
themes5
together5
community5
students5
35
bootstrapbase5
download5
would5
time5
better4
during4
sessions4
experience4
bas4
its4
startprep4
meeting4
rarr4
github4
44
clean4
fullimage4
student4
click4
online4
added4
device4
mobile4
last4
if4
did4
quality4
had4
free4
own4
going4
changes4
core4
which4
provide4
do4
could4
interfaces4
because4
friendly4
simple4
top4
plugins4
does4
brands4
that8217s4
implementing4
just4
without4
developing4
track4
teachers4
created4
courses4
web4
uses3
posts3
designed3
youtube3
video8217s3
works3
written3
well3
designers3
keep3
system3
simply3
them3
released3
html3
saint3
big3
bootswatches3
code3
53
become3
fun3
shamrock3
patricks3
multi3
post3
called3
custom3
tab3
question3
large3
data3
learn3
anesthesia3
making3
keeps3
css3
go3
every3
software3
ideas3
nice3
adding3
talk3
session3
enjoy3
once3
his3
share3
attendees3
hope3
can8217t3
coffee3
company3
however3
future3
make3
already3
lots3
power3
firefox3
parent3
main3
makes3
media3
quite3
tools3
need3
javascript3
shown3
mozilla3
years3
few3
small3
cool3
high3
website3
63
talks3
dj3
quizzes3
var3

Who hosts Sonsbeekmedia.nl?

Sonsbeekmedia.nl Hosting Provider Information

Hosted IP Address:178.79.155.254
Hosted Hostname:li274-254.members.linode.com
Service Provider:TELECITYGROUP INTERNATIONAL LIMITED
Hosted Country:United KingdomGB
Location Latitude:51.5164
Location Longitude:-0.093
Webserver Software:Apache/2.4.25 (Debian)

Is "TELECITYGROUP INTERNATIONAL LIMITED" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
TELECITYGROUP INTERNATIONAL LIMITED
0.0541%

HTTP Header Analysis for Sonsbeekmedia.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 30 Oct 2020 13:26:34 GMT
Server: Apache/2.4.25 (Debian)
Last-Modified: Tue, 28 Mar 2017 09:40:35 GMT
ETag: "9b6c-54bc7406ccac0-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 12933
Content-Type: text/html

Sonsbeekmedia.nl Domain Nameserver Information

HostIP AddressCountry
ns1.openprovider.nl 52.57.114.204
ns2.openprovider.be 52.214.115.96
ns3.openprovider.eu 52.56.134.244


Need to find out who hosts Sonsbeekmedia.nl?


Domain Registration (WhoIs) information for Sonsbeekmedia.nl

 Domain name: sonsbeekmedia.nl
Status: active

Registrar:
Registrar.eu
Kipstraat 3c5c
3011RR ROTTERDAM
Netherlands

Abuse Login to show email
Date: 2009-03-23

Updated Date: 2020-04-02

DNSSEC: yes

Domain nameservers:
ns1.openprovider.nl
ns2.openprovider.be
ns3.openprovider.eu

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Websites with Similar Names

Sonsbecker.de
Home | Sonsbecker Partyservice
Sonsbeekmedia.nl
BasBrands.nl
Sonsbrothersurgical.com
Sons Brother Surgical Instruments

Recently Updated Websites

757lrtp.org (6 seconds ago.)Skppr.org (8 seconds ago.)Cityoftshwanegov.org (11 seconds ago.)Fullertonvotesnoonj.org (12 seconds ago.)Holaofficial.org (14 seconds ago.)Altebra.org (14 seconds ago.)Cppt.org (15 seconds ago.)Consumerhealthprivacy.org (15 seconds ago.)Bigmaskitchen.org (17 seconds ago.)Hknatural.asia (21 seconds ago.)Dnlwdn.info (21 seconds ago.)Thefaceconcierge.info (23 seconds ago.)Icreatestudio.org (24 seconds ago.)Mbcom.org (24 seconds ago.)Premiumpets.org (25 seconds ago.)Forecashsports.org (28 seconds ago.)Verifydec9.info (29 seconds ago.)Stellahosting.org (30 seconds ago.)Gamesvideos.info (30 seconds ago.)Lafestadeltorrone.info (32 seconds ago.)Kidtopiausa.org (32 seconds ago.)Beautifultime.org (33 seconds ago.)Aftlafse.org (34 seconds ago.)757hampton.org (35 seconds ago.)Centerway.info (37 seconds ago.)Adventurenurse.org (37 seconds ago.)World-order.exposed (37 seconds ago.)Esupportteam.org (38 seconds ago.)Pecangrovemediation.org (38 seconds ago.)Executivecoachinginstituteforminoritywomen.org (38 seconds ago.)

Recently Searched Keywords

211 211 1 (1 second ago.)usask (1 second ago.)jam java jazz 2020 (1 second ago.)selectivedeclaration-tobeholdtoday (1 second ago.)javst (1 second ago.)sarı inşaat (2 seconds ago.)fffffefont-size 12pxmedia screen (2 seconds ago.)indslev brewery (2 seconds ago.)0sbackground rgba255 (2 seconds ago.)grossesse (3 seconds ago.)reclaimed wood (3 seconds ago.)agripoint jet institute bikaner (3 seconds ago.)quebec-rock (3 seconds ago.)research paper (4 seconds ago.)debian installbox (4 seconds ago.)deepomatic (5 seconds ago.)про підприємство (7 seconds ago.)对于业主 (7 seconds ago.)jueves 17 de octubre de 1945 (7 seconds ago.)医学类考试 (7 seconds ago.)青春 (2018版韩寒文集) (8 seconds ago.)адміністративні послуги (8 seconds ago.)heavensvm (9 seconds ago.)changing (9 seconds ago.)plescher crescent cambridge (9 seconds ago.)miten koronatesti otetaan (10 seconds ago.)view the whois data for deepomatic.us (10 seconds ago.)lhmchryslercherrycreek (10 seconds ago.)deepomatic.us is registered (11 seconds ago.)flippy (11 seconds ago.)