Your Pest Defense Inc. | Penticton, British Columbia

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Your Pest Defense Inc. in Penticton BC is family owned and operated, serving the residential, commercial, industrial, food processing and health industries.



Domain summary

Last updated
2021-09-24
Domain label
sospestcontrol
Domain extension
net
Domain registered:
2018-07-30
Domain updated:
2021-07-31
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Sospestcontrol.net registered?
A: Sospestcontrol.net was registered 3 years, 2 months, 3 weeks, 11 hours, 2 minutes, 5 seconds ago on Monday, July 30, 2018.
Q: When was the WHOIS for Sospestcontrol.net last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 6 days, 11 hours, 2 minutes, 5 seconds ago on Saturday, July 31, 2021.
Q: What are Sospestcontrol.net's nameservers?
A: DNS for Sospestcontrol.net is provided by the following nameservers:
  • ns23.domaincontrol.com
  • ns24.domaincontrol.com
Q: Who is the registrar for the Sospestcontrol.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Sospestcontrol.net?
A: Sospestcontrol.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Sospestcontrol.net each day?
A: Sospestcontrol.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Sospestcontrol.net resolve to?
A: Sospestcontrol.net resolves to the IPv4 address 184.168.131.241.
Q: In what country are Sospestcontrol.net servers located in?
A: Sospestcontrol.net has servers located in the United States.
Q: What webserver software does Sospestcontrol.net use?
A: Sospestcontrol.net is powered by Nginx webserver.
Q: Who hosts Sospestcontrol.net?
A: Sospestcontrol.net is hosted by AS-26496-GO-DADDY-COM-LLC in United States.
Q: How much is Sospestcontrol.net worth?
A: Sospestcontrol.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Sospestcontrol.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sospestcontrol.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sospestcontrol.net

H1 Headings

2 :
  1. Manage Penticton Pests with Your Pest Defense
  2. —Serving the Okanagan Valley—

H2 Headings

4 :
  1. Your Best Defense is Pest Defense!
  2. Bedbugs
  3. Termites
  4. Pest Animals

H3 Headings

6 :
  1. —If it bugs you, It Bugs Us!—
  2. Experienced Okanagan Exterminators
  3. Protect Your Business
  4. Protect Your Home
  5. Our Services
  6. Professional Affiliations

H4 Headings

2 :
  1. Your Pest Defense Inc.
  2. Hours

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

8 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sospestcontrol.net

your pestokanaganprotect yourcanwehelpprotectyouwe can helpmicewe canhomeantsusbugspest defensespidersrodentslikeyour pest defensecan helpcontrolpestspest controltermitesbusinesswaspsdefenseservicespestyoursquirrelsbirdsother

Who hosts Sospestcontrol.net?

Sospestcontrol.net Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:AS-26496-GO-DADDY-COM-LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "AS-26496-GO-DADDY-COM-LLC" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Sospestcontrol.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Fri, 24 Sep 2021 22:12:04 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 10269
Connection: keep-alive
X-Powered-By: PleskLin
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
X-Cache-Status: MISS
Strict-Transport-Security: max-age=15768000; includeSubDomains

Sospestcontrol.net Domain Nameserver Information

HostIP AddressCountry
ns23.domaincontrol.com 97.74.101.12
ns24.domaincontrol.com 173.201.69.12


Need to find out who hosts Sospestcontrol.net?


Domain Registration (WhoIs) information for Sospestcontrol.net

 Domain Name: sospestcontrol.net
Registry Domain ID: 2292109113_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-07-31T09:56:41Z
Creation Date: 2018-07-30T17:45:26Z
Registrar Registration Expiration Date: 2022-07-30T17:45:26Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Endymion Holdings Ltd
Registrant State/Province: British Columbia
Registrant Country: CA
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=sospestcontrol.net
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=sospestcontrol.net
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=sospestcontrol.net
Name Server: NS23.DOMAINCONTROL.COM
Name Server: NS24.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-09-24T22:12:06Z

Websites with Similar Names

Sospecha.com
HugeDomains.com
Sospecharasonable.com
Welcome to sospecharasonable.com
Sospecharazonable.com
Reasonable Suspicion Training - $44
Sospechas.info
hot russian teen fucks - sospechas.info
Sospechhulp.nl
Pechhulp in heel Nederland al voor 5,25 per maand | SOS Pechhulp
Sospecial.email
403 Forbidden
Sospecial.pl
SoSpecial.pl - Wizerunek i Stylizacja : SoSpecial.pl | Wizerunek i Stylizacja
Sospecialday.store
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Sospecies.org
Welcome to IUCN's Save Our Species Conservation Action Programme

Recently Updated Websites

Auservicedusalarie.com (2 seconds ago.)Wildcustomservices.com (4 seconds ago.)Modidairyshop.com (7 seconds ago.)Nyingmaorganizations.org (8 seconds ago.)Piwiq.com (8 seconds ago.)Thelogicalindians.com (9 seconds ago.)Botanicdeo.com (10 seconds ago.)Soraphotooffice.com (11 seconds ago.)Lovenjewels.com (12 seconds ago.)Zycie.info (12 seconds ago.)Pablophoto.net (14 seconds ago.)Haxbygrouptraining.com (14 seconds ago.)Judzks.ba (15 seconds ago.)Warkerparker.com (17 seconds ago.)Allprodigitall.com (20 seconds ago.)Sports-more.net (21 seconds ago.)Brams-technologies.com (24 seconds ago.)Ryancurtisrogers.com (24 seconds ago.)Philipautomotive.com (25 seconds ago.)Fergusonphotography.org (26 seconds ago.)Herbook.net (27 seconds ago.)Havethestrength.org (28 seconds ago.)Thedevopsgeek.com (28 seconds ago.)Rajgoyal.com (28 seconds ago.)Improveyourlunchlife.com (28 seconds ago.)Headless.de (30 seconds ago.)Bojanglesthestudiobourne.co.uk (30 seconds ago.)872727l.com (31 seconds ago.)Damiradental.org (31 seconds ago.)Shieldfish.com (31 seconds ago.)

Recently Searched Keywords

shelter dog toys (1 second ago.)dealsnbsp (1 second ago.)網紅 (2 seconds ago.)বাংলা (2 seconds ago.)khoa t (2 seconds ago.)doc (4 seconds ago.)���ο���� (5 seconds ago.)モーニングコールセンター (6 seconds ago.)then show (6 seconds ago.)porträts (8 seconds ago.)website archive (8 seconds ago.)natural deodorant (8 seconds ago.)style-kemw4faplabelwrapper (8 seconds ago.)pangeanic: translation agency (11 seconds ago.)3 miesiące temu (11 seconds ago.)art-oasis (12 seconds ago.)薬剤師求人ならリクナビ薬剤師 (15 seconds ago.)rows 4 clip (16 seconds ago.)group membership (16 seconds ago.)аэрозоли и кремы для обуви (17 seconds ago.)ice cream (19 seconds ago.)rafferty law (20 seconds ago.)tm hun luyn (22 seconds ago.)小孩尿床的原因有哪些? (22 seconds ago.)55 1084108610831086107610991093 10831102107610771081 (23 seconds ago.)hcleanerss (25 seconds ago.)venta carros monterrey (26 seconds ago.)password cancel subscription (30 seconds ago.)jfheader-menuwrapper jfheader-menulistitem jfheader-menulistlinkfont-sizecalc12px (33 seconds ago.)windows dev center (34 seconds ago.)