Soul Driven Life

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-30
Category: This site has not been categorized yet

Naturopathy and Counselling. Expand your mind, nourish your soul and nurture your body. Be the person you were born to be. Live the life you want to live. Do the things you want to do.


Domain summary

Domain label
souldrivenlife
Domain extension
net
Domain registered:
2019-12-09
Domain updated:
2019-12-09
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is souldrivenlife.net ranked relative to other sites:

Percentage of visits to souldrivenlife.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Souldrivenlife.net registered?
A: Souldrivenlife.net was registered 1 year, 1 month, 1 week, 3 days, 18 hours, 43 minutes, 52 seconds ago on Monday, December 9, 2019.
Q: When was the WHOIS for Souldrivenlife.net last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 1 week, 3 days, 18 hours, 43 minutes, 52 seconds ago on Monday, December 9, 2019.
Q: What are Souldrivenlife.net's nameservers?
A: DNS for Souldrivenlife.net is provided by the following nameservers:
  • giancarlo.ns.cloudflare.com
  • summer.ns.cloudflare.com
Q: Who is the registrar for the Souldrivenlife.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Souldrivenlife.net?
A: Souldrivenlife.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Souldrivenlife.net each day?
A: Souldrivenlife.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Souldrivenlife.net resolve to?
A: Souldrivenlife.net resolves to the IPv4 address 54.183.102.22.
Q: In what country are Souldrivenlife.net servers located in?
A: Souldrivenlife.net has servers located in the United States.
Q: What webserver software does Souldrivenlife.net use?
A: Souldrivenlife.net is powered by Openresty webserver.
Q: Who hosts Souldrivenlife.net?
A: Souldrivenlife.net is hosted by Amazon.com, Inc. in California, San Jose, United States, 95141.
Q: How much is Souldrivenlife.net worth?
A: Souldrivenlife.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Souldrivenlife.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Souldrivenlife.net Free SEO Report

Website Inpage Analysis for Souldrivenlife.net

H1 Headings

0 :

H2 Headings

1 :
  1. Social Feed

H3 Headings

0 :

H4 Headings

2 :
  1. Check out my latest updates!
  2. An Abundance of Blessings to YOU!

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

36 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-25124444-6

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Souldrivenlife.net

trueboxshadowsnavbardropdownsnavlinkcontainer acssfm1wpq snavbardesktopsnavbardesktopfixednotalternativefoundsheacssfm1wpq snavbardesktopsbglighttextsdonationsection scomponentsdonation sdonationprogress111111scustomcolors ssectionmobilecarticonpingfang tcmicrosoft jhengheistxiheisnavbardesktopsnavbardesktopfixedalternative snavitemsandlinksw3hiragino kaku gothicsnavliselectedhadsnavlisnavbardropdownsnavlihover snavli snavlinkcontainersnavbardesktopsnavbardesktopfixednotalternative snavitemsandlinks0 0cansnavbardesktop snavitemsandlinks snavlisnavbardropdownquestsoul drivensocial feedawesomelifekakuversionsoul drivensnavbardesktopsnavbardesktopfixednotalternative2px solidlisnavlisnavbardropdownsnavlihoverblessingsplayfair displaylogincontainersnavli snavlinkcontainercouldfeedawesomeeach2pxbestsecommerceshoppingcartwrapperself111111scustomcolorsfirstbutsnavitemsandlinks snavlisnavbardropdownsnavli snavliblogaboutspiritualoutprogressbarsnavlisnavbardropdownsnavlihover snavlisnavitemsandlinks snavliselectednew0secommerceproductswrapper secommercecardviewwrappersnavlisnavbardropdownsnavliselected1snavliselected snavlinkcontainer acssfm1wpqnowconsultationstestimonialsplain textbecomemediacallsoul driven blogaboutspiritualsecommercecardviewdetailkaku gothic proosakameiryoyour soulyousecommercerowviewproductsecommerce secommerceproductswrapperabundance of blessingsdisplayw3hiraginosansserifsnavlihoverrobotonavbardrawerstrikinglydrawer ulnavdrawerlistexperienceul litherenavcontainer navgothic proosakameiryocolor 111111scustomcolorsmanyscustomcolors navigator navcontainersandydrivensocial feedawesome videosconnectsnavlinkcontainer acssfm1wpq snavbardesktopsnavbardesktopfixedalternativejourney111111scustomcolors secommerce secommerceproductswrappervarwithinultimateloveacssfm1wpq snavbardesktopsnavbardesktopnormalsnavitemsandlinks snavlisnavbardropdownsnavlihover snavlihomeyour ultimateul acssfm1wpqtcmicrosoft jhengheistxiheireadsnavlinkcontainer acssfm1wpq snavbardesktopsnavbardesktopnormalgave mebecomingsansserif scontentsfontheadingrobotopgothicyoucolumnsbig mediacallsoulsemailformfieldsgrouphomeyour ultimate lifesnaviconsessencescolorgothic proosakameiryo mssnavbardesktop snavbardropdownyoucolumnsbig mediacallsoul drivenspiritualsnavbardesktopsbglighttext snaviconsbeingsnavlisnavbardropdownsnavlisdonationsectionpastwebsitesemailformfieldscustomcolorscategorylisttcmicrosoftcounsellingacolorinheritborderbottomcolortransparentcssfm1wpqintopingfangsnavitemsandlinks snavlihovercacaca1pxlife nowconsultationstestimonialsplain textbecomesnavlisnavbardropdownsnavli snavli snavlinkcontainerunderstandinghomeyourms pgothichavefeltread moresnavbardesktopsnavbardesktopnormalssection scategorybar categorylistsnavitemsandlinks snavlisnavbardropdownsnavliuseacssfm1wpq snavbardesktopsnavbardesktopfixedalternativesecommerce secommerceproductswrapper secommercecardviewwrappermediacallsouldriven blogaboutspiritualconsultationalsosnavlihover snavlinkcontainer aoutlinenonecolor111111cssfm1wpqacssfm1wpq snavbardesktopsnavbardesktopfixedalternative snavitemsandlinksimportantcssfm1wpqtodaysnavbardesktopsnavbardesktopfixedalternativesnavitemsandlinks snavlisnavbardropdownsnavliselectedsosnavli snavlinkcontainer acssfm1wpqseriflife nowconsultationstestimonialsplaincreatenavigator navcontaineracssfm1wpq snavbardesktopsnavbardesktopnormal snavitemsandlinksfunctionsnavbardesktopsbgdarktextsnavlinkcontainer acssfm1wpqdiscoveryscomponentsdonation sdonationprogress progressbarsnavlibeenpingfang tcmicrosoftscontentsfonttitleplayfairdisplaysnavlicssfm1wpq snavbardesktopjhengheistxiheiyourproosakameiryocsspn08x3gaveemotionalsnavbardesktopsecommercesnavlinkcontainer acolorinheritborderbottomcolortransparentcssfm1wpqmorefontfamily robotoessencergba17171702snavitemsandlinksproosakameiryo ms pgothicnavcontainersnavlinkcontainer aoutlinenonecolor111111cssfm1wpqsemailformfieldsgroup semailformfieldlikesnavlisnavbardropdownsnavli snavlisnavlisnavbardropdownmsslogotitlecssfm1wpqdriven blogaboutspiritual questsoulnavigator navcontainer navsecommercecardviewwrapper secommercecardviewdetail secommercecardviewdetailheaderblogaboutspiritual questsoulpersonmediacallsoul drivenscomponentsdonationacssfm1wpq snavbardesktopsnavbardesktopfixednotalternativesnavlisnavbardropdownsnavliselected snavli snavlinkcontainersecommerceproductswrapperaoutlinenonecolor111111cssfm1wpqconnectedsecommercecardviewwrapper secommercecardviewdetailfeelingssuncollapsednavhasedededssection scategorybarsecommercerowviewproduct mobileselectdoscontentsfontbodyroboto404040scustomcolorssnavlicssfm1wpqnavnavigatorsnavlisnavbardropdownsnavliselected snavlisnavbardesktopsbglighttextsnavitemsandlinks snavliselected snavlinkcontainersecommercecardviewcardsnavlihover snavlinkcontainer111111scustomcolors secommercefeelingthingsyou havevideosconnect homeyoursnavbardesktopsnavbardesktopnormal snavitemsandlinkssansserif scontentsfontbodyrobotodrivensocialpro w3hiraginoenergyquestsoul111111scustomcolors secommerceshoppingcartwrapperhelveticamyselfwhichserif scontentsfonttitleplayfairdisplayfeedawesome videosconnectnavbardrawerbarnotdraweropenbodysnavbardesktop snaviconshelped111111scustomcolors ssection scategorybarsnavliselected snavlinkcontainertextbecomebackgroundscustomcolors navigatoracssfm1wpqul acssfm1wpq snavbardesktopsbglighttextnavbardrawerstrikinglydrawerplayfairsnavitemsandlinks snavlisnavbardropdown1px solidallamdrivenmobileselectvideosconnect homeyour ultimatesolidroboto helveticacallbacksecommercecardviewdetail secommercecardviewdetailheaderscategorybarmessagesnavbardropdown ulkaku gothicultimate life nowconsultationstestimonialsplainscategorybar categorylistsnavitemsandlinks snavlisnavbardropdownsnavlihoverabundanceulnavdrawerlistsnavitemsandlinks snavlisnavbardropdownsnavliselected snavlinowconsultationstestimonialsplainfontfamilyquestsoul drivensocialvideosconnectawarenesssnavli snavlinkcontainer acolorinheritborderbottomcolortransparentcssfm1wpqacssfm1wpq snavbardesktopsnavbardesktopfixednotalternative snavitemsandlinksoneimportantcssfm1wpq snavbardesktopinnertoolsw3hiragino kakufontfamily playfairyourselfsnavitemsandlinks snavlihover snavlinkcontainerreallysdonationprogress111111scustomcolors secommercerowviewproduct mobileselectsnavbardesktop snavitemsandlinkspro w3hiragino kakusdonationprogress progressbarsessionstextbecome the bestprosoulsecommercecardviewwrappersecommerceproductswrapper secommercecardviewwrapper secommercecardviewdetaildrivensocial feedawesomeultimate lifeversion of youcolumnsbiggothicguidancefeedawesome videosconnect homeyourmindblogaboutspiritual questsoul drivensocialhelped mesecommercecardviewdetailheadersnavlinkcontainercssfm1wpqscomponentsdonation sdonationprogresswefontfamily roboto helveticabest versionmemy111111scustomcolors secommercerowviewproductulfontfamily playfair displayscontentsfontheadingrobotossectionsdonationsection scomponentsdonationproosakameiryo msexploresnavlinkcontainerreadingyoucolumnsbig

Longtail Keyword Density for Souldrivenlife.net

KeywordsOccurences
font-family roboto helvetica8
s-nav-li s-nav-link-container acss-fm1wpq7
s-ecommerce-card-view-wrapper s-ecommerce-card-view-detail s-ecommerce-card-view-detail-header6
s-ecommerce-products-wrapper s-ecommerce-card-view-wrapper s-ecommerce-card-view-detail6
s-ecommerce s-ecommerce-products-wrapper s-ecommerce-card-view-wrapper6
driven blogaboutspiritual questsoul5
mediacallsoul driven blogaboutspiritual5
youcolumnsbig mediacallsoul driven5
version of youcolumnsbig5
life nowconsultationstestimonialsplain textbecome5
ultimate life nowconsultationstestimonialsplain5
blogaboutspiritual questsoul drivensocial5
questsoul drivensocial feedawesome5
textbecome the best5
111111s-custom-colors s-ecommerce s-ecommerce-products-wrapper4
font-family playfair display4
navigator nav-container nav4
s-custom-colors navigator nav-container4
s-navbar-desktop s-nav-items-and-links s-nav-lis-navbar-dropdown4
acss-fm1wpq s-navbar-desktops-navbar-desktop-fixedalternative s-nav-items-and-links3
pingfang tcmicrosoft jhengheistxihei3
homeyour ultimate life3
videosconnect homeyour ultimate3
feedawesome videosconnect homeyour3
drivensocial feedawesome videosconnect3
s-nav-items-and-links s-nav-liselected s-nav-link-container3
s-nav-liselected s-nav-link-container acss-fm1wpq3
s-nav-link-container acss-fm1wpq s-navbar-desktops-navbar-desktop-normal3
acss-fm1wpq s-navbar-desktops-navbar-desktop-normal s-nav-items-and-links3
s-nav-items-and-links s-nav-lihover s-nav-link-container3
s-nav-lihover s-nav-link-container aoutlinenonecolor111111css-fm1wpq3
s-nav-items-and-links s-nav-lis-navbar-dropdowns-nav-li s-nav-li3
s-nav-lis-navbar-dropdowns-nav-li s-nav-li s-nav-link-container3
s-nav-items-and-links s-nav-lis-navbar-dropdowns-nav-liselected s-nav-li3
s-nav-lis-navbar-dropdowns-nav-liselected s-nav-li s-nav-link-container3
proosakameiryo ms pgothic3
111111s-custom-colors s-ecommerce-row-view-product mobile-select3
s-donation-section s-components-donation s-donation-progress3
111111s-custom-colors s-section s-category-bar3
s-section s-category-bar category-list3
s-nav-link-container acss-fm1wpq s-navbar-desktops-navbar-desktop-fixedalternative3
acss-fm1wpq s-navbar-desktops-navbar-desktop-fixednotalternative s-nav-items-and-links3
s-nav-link-container acss-fm1wpq s-navbar-desktops-navbar-desktop-fixednotalternative3
ul acss-fm1wpq s-navbar-desktops-bg-light-text3
s-components-donation s-donation-progress progress-bar3
gothic proosakameiryo ms3
s-nav-li s-nav-link-container acolorinheritborder-bottom-colortransparentcss-fm1wpq3
s-nav-lis-navbar-dropdowns-nav-lihover s-nav-li s-nav-link-container3
s-nav-items-and-links s-nav-lis-navbar-dropdowns-nav-lihover s-nav-li3
pro w3hiragino kaku3
w3hiragino kaku gothic3
kaku gothic proosakameiryo3
abundance of blessings3
s-navbar-desktop s-nav-items-and-links11
s-nav-li s-nav-link-container10
s-nav-link-container acss-fm1wpq10
roboto helvetica8
font-family roboto8
best version7
s-ecommerce-card-view-wrapper s-ecommerce-card-view-detail6
s-ecommerce-products-wrapper s-ecommerce-card-view-wrapper6
111111s-custom-colors s-ecommerce-row-view-product6
s-navbar-desktop s-navbar-dropdown6
s-ecommerce s-ecommerce-products-wrapper6
s-ecommerce-card-view-detail s-ecommerce-card-view-detail-header6
s-navbar-desktops-navbar-desktop-fixedalternative s-nav-items-and-links5
life nowconsultationstestimonialsplain5
s-navbar-desktops-navbar-desktop-fixednotalternative s-nav-items-and-links5
s-custom-colors navigator5
ultimate life5
nowconsultationstestimonialsplain textbecome5
1px solid5
youcolumnsbig mediacallsoul5
drivensocial feedawesome5
questsoul drivensocial5
blogaboutspiritual questsoul5
driven blogaboutspiritual5
s-navbar-desktops-bg-light-text s-nav-icons5
s-navbar-desktops-navbar-desktop-normal s-nav-items-and-links5
mediacallsoul driven5
111111s-custom-colors s-ecommerce5
navigator nav-container4
nav-container nav4
font-family playfair4
s-navbar-desktop s-nav-icons4
playfair display4
soul driven4
gave me4
s-nav-licss-fm1wpq s-navbar-desktop4
acss-fm1wpq s-navbar-desktops-bg-light-text4
importantcss-fm1wpq s-navbar-desktop4
s-email-form-fields-group s-email-form-field4
s-nav-items-and-links s-nav-lis-navbar-dropdown4
color 111111s-custom-colors3
s-nav-lis-navbar-dropdowns-nav-li s-nav-li3
s-nav-items-and-links s-nav-lis-navbar-dropdowns-nav-li3
serif s-contents-font-title-playfair-display3
sans-serif s-contents-font-heading-roboto3
s-nav-link-container aoutlinenonecolor111111css-fm1wpq3
s-nav-lihover s-nav-link-container3
s-nav-items-and-links s-nav-lihover3
acss-fm1wpq s-navbar-desktops-navbar-desktop-normal3
s-nav-liselected s-nav-link-container3
ul acss-fm1wpq3
s-nav-items-and-links s-nav-liselected3
pingfang tcmicrosoft3
ul li3
feedawesome videosconnect3
videosconnect homeyour3
homeyour ultimate3
s-navbar-dropdown ul3
your soul3
helped me3
you have3
tcmicrosoft jhengheistxihei3
ms pgothic3
s-ecommerce-row-view-product mobile-select3
s-nav-link-container acolorinheritborder-bottom-colortransparentcss-fm1wpq3
111111s-custom-colors s-ecommerce-shopping-cart-wrapper3
111111s-custom-colors s-section3
s-section s-category-bar3
s-category-bar category-list3
2px solid3
acss-fm1wpq s-navbar-desktops-navbar-desktop-fixedalternative3
acss-fm1wpq s-navbar-desktops-navbar-desktop-fixednotalternative3
s-donation-section s-components-donation3
s-components-donation s-donation-progress3
s-donation-progress progress-bar3
s-nav-lis-navbar-dropdowns-nav-lihover s-nav-li3
proosakameiryo ms3
s-nav-items-and-links s-nav-lis-navbar-dropdowns-nav-lihover3
0 03
navbar-drawerstrikingly-drawer ulnav-drawer-list3
s-nav-lis-navbar-dropdowns-nav-liselected s-nav-li3
s-nav-items-and-links s-nav-lis-navbar-dropdowns-nav-liselected3
sans-serif s-contents-font-body-roboto3
pro w3hiragino3
w3hiragino kaku3
kaku gothic3
gothic proosakameiryo3
read more3
s-navbar-desktop61
your31
111111s-custom-colors29
you26
s-nav-items-and-links26
life18
me16
s-nav-link-container16
s-nav-li15
acss-fm1wpq14
s-navbar-desktops-bg-light-text13
my13
soul12
felt12
font-family12
more12
ul11
solid10
li10
driven9
s-ecommerce-card-view-wrapper9
have9
css-pn08x39
she9
s-nav-icons9
sans-serif8
helvetica8
s-ecommerce-row-view-product8
roboto8
s-ecommerce8
s-navbar-dropdown8
08
1px8
out7
version7
best7
like7
journey7
s-custom-colors7
all7
sandy7
s-nav-licss-fm1wpq7
s-navbar-desktops-navbar-desktop-normal6
s-contents-font-body-roboto6
rgba171717026
s-contents-font-heading-roboto6
s-ecommerce-card-view-detail-header6
s-ecommerce-card-view-detail6
s-ecommerce-products-wrapper6
into6
abundance6
new6
really6
pingfang6
which6
we6
s-contents-font-title-playfair-display6
nowconsultationstestimonialsplain5
ultimate5
youcolumnsbig5
had5
mediacallsoul5
blogaboutspiritual5
questsoul5
drivensocial5
feedawesome5
body5
guidance5
feelings5
feeling5
has5
could5
so5
reading5
things5
yourself5
textbecome5
pro5
s-navbar-desktops-bg-dark-text5
s-navbar-desktops-navbar-desktop-fixedalternative5
navigator5
s-navbar-desktops-navbar-desktop-fixednotalternative5
login-container5
color5
s-section5
s-nav-lis-navbar-dropdown4
also4
self4
discovery4
explore4
essences4
many4
14
2px4
background4
gave4
s-ecommerce-shopping-cart-wrapper4
there4
essence4
importantcss-fm1wpq4
sessions4
playfair4
function4
var4
true4
navbar-drawer-barnotdrawer-open4
nav-container4
nav4
becoming4
website4
s-email-form-field4
s-email-form-fields-group4
can4
serif4
display4
s-nav-lis-navbar-dropdowns-nav-li3
experience3
s-nav-lis-navbar-dropdowns-nav-lihover3
acolorinheritborder-bottom-colortransparentcss-fm1wpq3
s-nav-lihover3
first3
aoutlinenonecolor111111css-fm1wpq3
s-nav-lis-navbar-dropdowns-nav-liselected3
proosakameiryo3
myself3
within3
love3
use3
read3
blessings3
s-logo-titlecss-fm1wpq3
today3
spiritual3
am3
energy3
found3
been3
s-nav-link-containercss-fm1wpq3
helped3
person3
s-nav-liselected3
but3
awareness3
each3
s-uncollapsed-nav3
videosconnect3
s-donation-section3
s-components-donation3
s-donation-progress3
progress-bar3
box-shadow3
ededed3
cacaca3
404040s-custom-colors3
navbar-drawerstrikingly-drawer3
ulnav-drawer-list3
w3hiragino3
kaku3
jhengheistxihei3
tcmicrosoft3
gothic3
pgothic3
homeyour3
category-list3
one3
understanding3
connected3
create3
mobile-cart-icon3
message3
ms3
being3
s-ecommerce-card-view-card3
past3
s-category-bar3
emotional3
consultation3
counselling3
do3
tools3
inner3
mind3
mobile-select3
callback3

Who hosts Souldrivenlife.net?

Souldrivenlife.net Hosting Provider Information

Hosted IP Address:54.183.102.22
Hosted Hostname:ec2-54-183-102-22.us-west-1.compute.amazonaws
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:37.3388
Location Longitude:-121.8914
Webserver Software:openresty

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Souldrivenlife.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Mon, 30 Nov 2020 17:48:11 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Cache-Control: max-age=0, public, must-revalidate
ETag: W/"bc1e094c1fb4cf91b8b2ff249008e324"
Last-Modified: Fri, 11 Sep 2020 21:31:27 GMT
X-Content-Type-Options: nosniff
X-Request-Id: f4aa446b9e8fa4a4b47de1e0a551e977
X-Runtime: 1.060664
X-XSS-Protection: 1; mode=block
Content-Encoding: gzip

Souldrivenlife.net Domain Nameserver Information

HostIP AddressCountry
giancarlo.ns.cloudflare.com 162.159.44.5
summer.ns.cloudflare.com 162.159.38.9


Need to find out who hosts Souldrivenlife.net?


Domain Registration (WhoIs) information for Souldrivenlife.net

 Domain Name: SOULDRIVENLIFE.NET
Registry Domain ID: 2464965381_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-12-09T00:54:15Z
Creation Date: 2019-12-09T00:53:59Z
Registry Expiry Date: 2020-12-09T00:53:59Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok https://icann.org/epp#ok
Name Server: GIANCARLO.NS.CLOUDFLARE.COM
Name Server: SUMMER.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-11-30T17:47:59Z

Websites with Similar Names

Sould.live
sould.live is parked
Sould.org
sould.org – SOUL'D Designs - | Christian T-Shirts, Christian Accessories, Designer SOUL’D T-Shirts and More – sould.org
Souldads.com
SoulDads - Single Parenting 101SoulDads
Souldaisy.com
Souldaisy Clothing Designs - A Canadian Clothing Design Company - Wholesale Women's Wear
Souldamgood.com
Soul Dam Good - Good Food = Good Mood

Recently Updated Websites

Theappleapartments.com (1 minute 59 seconds ago.)Jxbt.me (1 minute 59 seconds ago.)Annaithai.com (1 minute 59 seconds ago.)Hobbyshopphilippines.com (5 minutes 17 seconds ago.)Nibiru.pl (5 minutes 17 seconds ago.)Win8857.com (10 minutes 47 seconds ago.)Jcvcares.com (12 minutes 48 seconds ago.)Senderpro.com (13 minutes 28 seconds ago.)Ldp53.com (13 minutes 35 seconds ago.)911ep.com (13 minutes 35 seconds ago.)Thunderphoto.com (13 minutes 43 seconds ago.)Covidtracenc.com (13 minutes 49 seconds ago.)Covid19-kill.ca (13 minutes 50 seconds ago.)1svn.com (13 minutes 50 seconds ago.)Hindiapps.com (13 minutes 50 seconds ago.)Weddingpaymentplan.com (13 minutes 50 seconds ago.)Upstracker.com (13 minutes 50 seconds ago.)Pihq.com (13 minutes 50 seconds ago.)O2-hansatel.de (13 minutes 50 seconds ago.)Naimkhan.com (13 minutes 50 seconds ago.)Sr-lighting.net (13 minutes 50 seconds ago.)Crocus.net (13 minutes 50 seconds ago.)Milikku.id (13 minutes 50 seconds ago.)Impexconsultancy.net (13 minutes 50 seconds ago.)Jaycitynews.com (13 minutes 50 seconds ago.)Akkev.com (13 minutes 50 seconds ago.)Ozlemradyo.com (13 minutes 50 seconds ago.)Eistanbul.net (13 minutes 50 seconds ago.)Readyroblox.com (13 minutes 50 seconds ago.)Vangelus.com (13 minutes 50 seconds ago.)

Recently Searched Keywords

специальности (1 second ago.)dostips string manipulation (2 seconds ago.)06.10.202006.10.2020 (3 seconds ago.)yvateam (5 seconds ago.)follow @mdo (5 seconds ago.)raft (6 seconds ago.)excel formulas percentage of a number (7 seconds ago.)ղեկավար կազմ (7 seconds ago.)фотографии (8 seconds ago.)le-manoir-du-pays-dauge (8 seconds ago.)webhosting frontpage hosting (8 seconds ago.)livheim.com (9 seconds ago.)bostancı escort (9 seconds ago.)search term (10 seconds ago.)mature nl hunter (13 seconds ago.)męskie buty (13 seconds ago.)livheim.com (14 seconds ago.)mebeverine (15 seconds ago.)associado (16 seconds ago.)our developers (16 seconds ago.)0px border-bottom-right-radius (16 seconds ago.)enim iaculis (17 seconds ago.)sted (17 seconds ago.)==> tham khảo địa chỉ của các đại lý của mực khô bá kiến tại  đây <== (19 seconds ago.)iconos (19 seconds ago.)pre-planning form (19 seconds ago.)insurance plans (20 seconds ago.)love your bookshop (20 seconds ago.)tienda bisutería (21 seconds ago.)回到首页 (21 seconds ago.)