🚀space | Amazing facts,History,Formation and more...

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Space is the boundless three-dimensional extent in which objects and events have relative position and direction.space is everything that you can find outside Earth’s atmosphere No particles, no air, nothing



Domain summary

Last updated
2020-10-10
Domain label
spacescience
Domain extension
xyz
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is spacescience.xyz ranked relative to other sites:

Percentage of visits to spacescience.xyz from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Spacescience.xyz registered?
A: Spacescience.xyz was registered 7 months, 4 days, 16 hours, 41 minutes, 13 seconds ago on Saturday, October 10, 2020.
Q: When was the WHOIS for Spacescience.xyz last updated?
A: The WHOIS entry was last updated 7 months, 4 days, 16 hours, 41 minutes, 13 seconds ago on Saturday, October 10, 2020.
Q: What are Spacescience.xyz's nameservers?
A: DNS for Spacescience.xyz is provided by the following nameservers:
  • ns16.domaincontrol.com
  • ns15.domaincontrol.com
Q: Who is the registrar for the Spacescience.xyz domain?
A: The domain has been registered at .
Q: What is the traffic rank for Spacescience.xyz?
A: Spacescience.xyz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Spacescience.xyz each day?
A: Spacescience.xyz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Spacescience.xyz resolve to?
A: Spacescience.xyz resolves to the IPv4 address 148.66.138.111.
Q: In what country are Spacescience.xyz servers located in?
A: Spacescience.xyz has servers located in the Singapore.
Q: What webserver software does Spacescience.xyz use?
A: Spacescience.xyz is powered by Apache webserver.
Q: Who hosts Spacescience.xyz?
A: Spacescience.xyz is hosted by AS-26496-GO-DADDY-COM-LLC in Singapore, Singapore, 18.
Q: How much is Spacescience.xyz worth?
A: Spacescience.xyz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Spacescience.xyz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Spacescience.xyz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Spacescience.xyz

H1 Headings

7 :
  1. Space Science
  2. Silence In Space
  3. Amazing Space
  4. Time Travel
  5. Space X
  6. Nasa
  7. Parallel Universe

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

12 :
  1. Galaxies In space
  2. Milky-Way
  3. Rain On Venus
  4. The Diamond Planet
  5. Life On Mars
  6. Black Hole
  7. Hot Sun
  8. The Saturn Ring
  9. International Space Station
  10. Earth
  11. Moon
  12. Our Solar System

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

3 :

Google Adsense

:
pub-6962829486095316

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Spacescience.xyz

universetime travel0lightagencyenergyheprivate companyfalconphysicistsplanetsthesespacetimehasowngeneralthroughwesopossibleexistprivatenoevenorbitdragonsolutionsstationotherstheorypastmanyspacecraftearthallowparticlesrelativitysomenasaspacexthanwouldgeneral relativitybetweenintolaunchclosedsuchhearcrewuniversestravel throughyoualldifferentour universehisfirst privatehomewithinaeronauticsfurthercaneachtravelparallelmultiversespacehavelikefirst private companyparallel universesrocketinternational spacecontactothermachinesimplyfirstmaytimewellnotoneinternational space stationwavewhichinternationalsoundussystemonestherecompanywavesbecausebutourvacuumtime machinescienceifbelievespace stationtravelsaround

Longtail Keyword Density for Spacescience.xyz

KeywordsOccurences
international space station6
first private company4
time travel9
space station7
international space6
general relativity4
first private4
private company4
travel through3
time machine3
our universe3
parallel universes3
space41
time18
travel13
have13
these12
universes9
through8
our8
vacuum8
you8
sound8
first8
dragon7
we7
one7
nasa7
many7
such7
universe7
station7
has6
he6
earth6
relativity6
particles6
launch6
spacecraft6
parallel6
if6
international6
us6
company5
so5
science5
waves5
wave5
can5
may5
would5
because4
general4
than4
there4
spacetime4
his4
crew4
falcon4
private4
no4
some4
other4
which4
well4
not4
light4
multiverse3
rocket3
others3
like3
hear3
all3
energy3
home3
orbit3
contact3
travels3
spacex3
03
planets3
aeronautics3
agency3
system3
around3
ones3
solutions3
different3
machine3
past3
possible3
within3
further3
between3
exist3
each3
even3
into3
simply3
physicists3
closed3
own3
but3
believe3
theory3
allow3

Who hosts Spacescience.xyz?

Spacescience.xyz Hosting Provider Information

Hosted IP Address:148.66.138.111
Hosted Hostname:148.66.138.111
Service Provider:AS-26496-GO-DADDY-COM-LLC
Hosted Country:SingaporeSG
Location Latitude:1.3036
Location Longitude:103.8554
Webserver Software:Apache

Is "AS-26496-GO-DADDY-COM-LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
%

HTTP Header Analysis for Spacescience.xyz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 10 Oct 2020 22:10:41 GMT
Server: Apache
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Thu, 08 Oct 2020 05:49:32 GMT
ETag: "40c00a5-41db-5b122656ae4e8-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 6076
Content-Type: text/html

Spacescience.xyz Domain Nameserver Information

HostIP AddressCountry
ns16.domaincontrol.com 173.201.75.8
ns15.domaincontrol.com 97.74.107.8


Need to find out who hosts Spacescience.xyz?


Domain Registration (WhoIs) information for Spacescience.xyz

 Domain Name: SPACESCIENCE.XYZ
Registry Domain ID: D203332698-CNIC
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.godaddy.com/
Updated Date: 2020-10-07T16:44:49.0Z
Creation Date: 2020-10-07T16:44:47.0Z
Registry Expiry Date: 2021-10-07T23:59:59.0Z
Registrar: Go Daddy, LLC
Registrar IANA ID: 146
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant Organization:
Registrant State/Province: Maharashtra
Registrant Country: IN
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: NS15.DOMAINCONTROL.COM
Name Server: NS16.DOMAINCONTROL.COM
DNSSEC: unsigned
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4805058800
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-10T22:10:41.0Z > IMPORTANT INFORMATION ABOUT THE DEPLOYMENT OF RDAP: please visit
https://www.centralnic.com/support/rdap

Websites with Similar Names

Space-----out.com
Space – Space Online Store
Space-129873-1gs5.space
fovebo yabe lacu
Space-129874-1gs3.space
cinafu zuyuyawe tihukosi
Space-129874-1gs4.space
Срок регистрации домена space-129874-1gs4.space истёк
Space-2198-0gs3.space
Красотка без комплексов
Space-2198-0gs4.space
musovi yefoso wopezigu
Space-287457-1gs8.space
lice zanupa jorexuyo

Recently Updated Websites

Venu.direct (3 seconds ago.)Antadent.com (4 seconds ago.)Selfdrivingbyton.com (4 seconds ago.)Exobulle.online (5 seconds ago.)Pensiuneaingrid.ro (5 seconds ago.)Enelko.com.tr (6 seconds ago.)Svswitch.com (7 seconds ago.)Guerratacadista.com (8 seconds ago.)Heath.biz (8 seconds ago.)Jillonthehill.com (8 seconds ago.)Ciga.org.uk (8 seconds ago.)Solgaz.eu (8 seconds ago.)Signature22pa.com (9 seconds ago.)Isaiahsbodega.com (9 seconds ago.)Bws9901.com (10 seconds ago.)Auckwood.net (10 seconds ago.)Innovativepropertymaintenance.online (10 seconds ago.)Rxsyj.com (10 seconds ago.)Zjhhcy.net (11 seconds ago.)Doctorinyourcity.com (12 seconds ago.)Biohackeruniverse.com (13 seconds ago.)Californialifecare.com (13 seconds ago.)Weser-industrieverpackungen.com (13 seconds ago.)Kddentistry.com (13 seconds ago.)Apikgopik.com (13 seconds ago.)Darasteam.com (13 seconds ago.)Conisar.org (13 seconds ago.)Funpianobooks.com (14 seconds ago.)Groow.net (14 seconds ago.)Whitemountainherbs.com (14 seconds ago.)

Recently Searched Keywords

powder can (1 second ago.)g236 v (1 second ago.)color 444444 (2 seconds ago.)φάρμακα γονιμότητας, kαρκίνος μήτρας- ωοθηκών και μαστού. υπάρχει σχέση (3 seconds ago.)help protect critical koala habitats (3 seconds ago.)experience the golgari (4 seconds ago.)divtdi59887 td-big-grid-flex-post clear (5 seconds ago.)sectionsname sectionsnamedisableautoscroll (7 seconds ago.)vibrates (10 seconds ago.)露天風呂 (12 seconds ago.)lễ dâng hương – thắp nến tri ân các anh hùng liệt sỹ tại nghĩa trang xã hồng phong năm 2013 (14 seconds ago.)dotstrue (15 seconds ago.)localmontserrat thin (18 seconds ago.)vashikaran love (19 seconds ago.)numberdefaultcancelbuttonlabelcancelbyappointmentby appointmentdefaultsubmitbuttonlabelsendunsupportedfiletypeunsupported file (21 seconds ago.)fernandarojas (21 seconds ago.)replica.is (22 seconds ago.)kufri call girls (24 seconds ago.)küresel sendikal haklar raporunda türkiye en kötü 10 ülke arasındaki yerini korudu! (24 seconds ago.)thermal receipt printer driver (25 seconds ago.)business (25 seconds ago.)küresel sendikal haklar raporunda türkiye en kötü 10 ülke arasındaki yerini korudu! (26 seconds ago.)contact us (26 seconds ago.)texas rangers rescue baby thrown into rio grande by smugglers (27 seconds ago.)[彩虹云盘] (30 seconds ago.)valuables (30 seconds ago.)farmosorg (30 seconds ago.)baskets (31 seconds ago.)buy flowers (33 seconds ago.)yoga artikelen 27 producten (34 seconds ago.)