Sparkasse-osterode.de  |  Sparkasse Osterode am Harz (263 510 15) - Internet-Filiale
Low trust score  | 
Die Internetfiliale der Sparkasse Osterode am HarzDie Internetfiliale der Sparkasse Osterode am Harz

Sparkasse-osterode.de Website Information

Sparkasse-osterode.de has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 442,483, a Majestic Rank of 0, a Domain Authority of 34% and is not listed in DMOZ.

Sparkasse-osterode.de is hosted by Finanz Informatik GmbH & Co. KG in Germany.
Sparkasse-osterode.de has an IP Address of 62.181.144.247 and a hostname of 62.181.144.247.

The domain sparkasse-osterode.de was registered 201 decades 8 years 10 months ago by , it was last modified 6 years 1 month 6 days ago and currently is set to expire 201 decades 8 years 10 months ago.


Whois information for sparkasse-osterode.de

Full Whois Lookup for Sparkasse-osterode.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: sparkasse-osterode.de
Nserver: ns1.s-fg-net.de
Nserver: ns2.s-fg-net.com
Nserver: ns4.s-fg-net.de
Status: connect
Changed: 2016-06-08T16:25:01+02:00

[Tech-C]
Type: ROLE
Name: Finanz Informatik GmbH & Co. KG
Organisation: Finanz Informatik GmbH & Co. KG
Address: Laatzener Str. 5
PostalCode: 30539
City: Hannover
CountryCode: DE
Phone: +49-511-510259012
Fax: +49-0-0
Email: Login to show email
Telefax: +49-511-51021759012
Changed: 2013-08-05T09:54:06+02:00

[Zone-C]
Type: ROLE
Name: Finanz Informatik GmbH & Co. KG
Organisation: Finanz Informatik GmbH & Co. KG
Address: Laatzener Str. 5
PostalCode: 30539
City: Hannover
CountryCode: DE
Phone: +49-511-510259012
Fax: +49-0-0
Email: Login to show email
Telefax: +49-511-51021759012
Changed: 2013-08-05T09:54:06+02:00

Who hosts Sparkasse-osterode.de?

Sparkasse-osterode.de Web Server Information

Hosted IP Address:62.181.144.247
Hosted Hostname:62.181.144.247
Service Provider:Finanz Informatik GmbH & Co. KG
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:unknown

HTTP Header Analysis for Sparkasse-osterode.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 02 Aug 2015 17:59:45 GMT
X-Frame-Options: deny
Cache-Control: no-cache,no-store,private
Pragma: no-cache
Expires: 0
X-Cnection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Content-Language: de-DE


Need to find out who hosts Sparkasse-osterode.de?

Sparkasse-osterode.de Free SEO Report

Website Inpage Analysis for Sparkasse-osterode.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Sparkasse-osterode.de

ist100x100eurofreundebisfilialesieihnengewinnenmitjetztfr siefrderserviceswirihrersparkasseonlinebankingdekabasisanlagemehroderfiliale findendieihremehr erfahrengemeinsamerfahrenbaufinanzierungkwittfindenganzzufreunde zuausbildungganz einfacheineeinfachimist einfachihren

Longtail Keyword Density for Sparkasse-osterode.de

KeywordsOccurences
mehr erfahren6
ist einfach4
fr sie4
freunde zu3
filiale finden3
ganz einfach3
einfach10
sie9
mehr8
zu7
der6
erfahren6
filiale5
kwitt5
fr5
gemeinsam5
oder4
ist4
eine4
ihrer4
mit4
die4
finden4
wir4
sparkasse4
online-banking3
ausbildung3
services3
deka-basisanlage3
im3
baufinanzierung3
bis3
freunde3
ganz3
100x100euro3
ihre3
jetzt3
ihren3
ihnen3
gewinnen3

What are the nameservers for sparkasse-osterode.de?

Sparkasse-osterode.de Domain Nameserver Information

HostIP AddressCountry
ns1.sko-net.de 62.181.135.87Germany Germany
ns2.sko-net.com 195.140.118.7Germany Germany
ns3.sko-net.eu 195.140.44.40Germany Germany

Sparkasse-osterode.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Sparkasse-osterode.de is a scam?