Gratis Spel - Spela gratisspel online på spela.se

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-27
Category: Games > Video Games

Spela de bästa gratisspelen online: racingspel, zombiespel och massor av andra roliga spel!


Domain summary

Domain label
spela
Domain extension
se
Domain registered:
2006-08-14
Domain updated:
2020-10-27
Domain expires:
2022-01-19
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is spela.se ranked relative to other sites:

Percentage of visits to spela.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Spela.se registered?
A: Spela.se was registered 14 years, 6 months, 2 weeks, 4 days, 19 hours, 36 minutes, 29 seconds ago on Monday, August 14, 2006.
Q: When was the WHOIS for Spela.se last updated?
A: The WHOIS entry was last updated 4 months, 5 days, 19 hours, 36 minutes, 29 seconds ago on Tuesday, October 27, 2020.
Q: What are Spela.se's nameservers?
A: DNS for Spela.se is provided by the following nameservers:
  • ns-cloud-a4.googledomains.com
  • ns-cloud-a3.googledomains.com
  • ns-cloud-a2.googledomains.com
  • ns-cloud-a1.googledomains.com
Q: Who is the registrar for the Spela.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Spela.se?
A: Spela.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Spela.se each day?
A: Spela.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Spela.se resolve to?
A: Spela.se resolves to the IPv4 address 34.95.108.35.
Q: In what country are Spela.se servers located in?
A: Spela.se has servers located in the United States.
Q: What webserver software does Spela.se use?
A: Spela.se is powered by Openresty webserver.
Q: Who hosts Spela.se?
A: Spela.se is hosted by DoD Network Information Center in United States.
Q: How much is Spela.se worth?
A: Spela.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Spela.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Spela.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Spela.se

H1 Headings

1 :
  1. Gratis onlinespel på Spela.se

H2 Headings

15 :
  1. SKAFFA ETT KONTO OCH
  2.  
  3. Redaktörens val
  4. I fokus/Heta spel
  5. För dig
  6. Nya spel
  7. Kolla in våra speciella
  8. Halloween
  9. Veckans topplista
  10. Flera spelare-spel
  11. Premium-spel
  12. Spela med vänner!
  13. Barnspel
  14. Friv Spel
  15. Populära spel

H3 Headings

21 :
  1. Toppkategorier
  2. Bästa spel
  3. Toppkategorier
  4. Bästa spel
  5. Toppkategorier
  6. Bästa spel
  7. Toppkategorier
  8. Bästa spel
  9. Toppkategorier
  10. Bästa spel
  11. Toppkategorier
  12. Bästa spel
  13. Toppkategorier
  14. Bästa spel
  15. För dig
  16. Mina senast spelade spel
  17. FAVORITSPEL
  18. Inga nedladdningar, inga prenumerationer – det är bara att klicka och spela!
  19. Var med i en spelcommunity!
  20. Våra populäraste kategorier!
  21. Om oss

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

3 :
  1. FÖRETAGSINFO
  2. SUPPORT
  3. Språk

Total IFRAMEs

1 :

Total Images

216 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

252:

Links - Internal (nofollow)

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Spela.se

x trailracingellerradattkontofunctionbubbleharfoumlrbubble shooterpescapeduclassicpaperconnectnbsp nbsp nbsp1nbsp nbspmicrosoftonlinespeloutfleraxfleravansiktsmlningspelarevattenflickankortdetnaringgotsuperfireboytilesbsta spel3solitairetillochboballeaumlrbstahalloweenvill3daumlvenpianoboumlrjadina favoritspelgamespelatoppkategoriervaringranbspmahjongpusselmatchmultiplayerettpuzzlekandinaallagoodgamefireboy and watergirldigmakermedfrmatchasimulatorbarnconsttrailracing0visponsrad nbspandrafavoritspelwatergirlsponsrad2spelfr digeldpojkenett kontofarmludosomvi harshooterparing

Who hosts Spela.se?

Spela.se Hosting Provider Information

Hosted IP Address:34.95.108.35
Hosted Hostname:35.108.95.34.bc.googleusercontent.com
Service Provider:DoD Network Information Center
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:openresty

Is "DoD Network Information Center" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%

HTTP Header Analysis for Spela.se

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: openresty
Date: Tue, 27 Oct 2020 17:00:24 GMT
Content-Type: text/html
Content-Length: 178
Location: https://www.spela.se/
X-TT: 0
X-Response-Time: 0.001
Via: 1.1 google

Spela.se Domain Nameserver Information

HostIP AddressCountry
ns-cloud-a4.googledomains.com 216.239.38.106
ns-cloud-a3.googledomains.com 216.239.36.106
ns-cloud-a2.googledomains.com 216.239.34.106
ns-cloud-a1.googledomains.com 216.239.32.106


Need to find out who hosts Spela.se?


Domain Registration (WhoIs) information for Spela.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: spela.se
holder: OPEEE0114-73
admin-c: OPEEE0114-73
tech-c: OPEEE0114-73
billing-c: -
created: 2006-08-14
modified: 2020-10-13
expires: 2022-01-19
transferred: 2020-10-13
nserver: ns-cloud-a1.googledomains.com
nserver: ns-cloud-a2.googledomains.com
nserver: ns-cloud-a3.googledomains.com
nserver: ns-cloud-a4.googledomains.com
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: Registrar.eu

Websites with Similar Names

Spela-bingo.com
spela-bingo.com Is for Sale
Spela-inform.com
Hypnobirthing | Djotish | Inform | Spela Mrak Cirikovic – Information for transformation
Spela-och-vinn.com
403 Forbidden
Spela-roulette.net
Binero Webbhotell - vänligast på webben
Spela-se.com
Coming Soon - Future home of something quite cool
Spela-spel.org
Spel - Spela spel
Spela.academy
Explore Education programs and college rating – Compare them by cost and programs
Spela.es
spela.es

Recently Updated Websites

Punhosunidos.com (2 seconds ago.)Cityneom.com (2 seconds ago.)Unicorn.love (4 seconds ago.)Sma-norge.no (7 seconds ago.)Svedbrosmide.se (8 seconds ago.)Pitrealty.com (9 seconds ago.)Tobaccoendgame.it (10 seconds ago.)Ajoy.in (11 seconds ago.)Firstochat.com (11 seconds ago.)Stmariaschoolranchi.com (11 seconds ago.)Everlast.tech (12 seconds ago.)Zeitoonrestaurant.com (13 seconds ago.)Nutterconstruction.com (13 seconds ago.)Zwollefbc.com (16 seconds ago.)Easyequip.co.uk (18 seconds ago.)Yetiyen.com (21 seconds ago.)Cuevagroup.com (23 seconds ago.)Cubanhotdog.com (25 seconds ago.)Greatergoldenmbc.com (26 seconds ago.)Globalriskradar.com (31 seconds ago.)Haleinvestmentgroup.net (33 seconds ago.)Lopezmehr.info (34 seconds ago.)Sopiano.com (35 seconds ago.)Pianoemail.com (37 seconds ago.)Cincinkawinsemarang.com (38 seconds ago.)Moreanfamilyoffice.com (39 seconds ago.)Barryberelowitz.com (40 seconds ago.)Ymcafamilieson.org (41 seconds ago.)Linksyssmsrtwifi.com (41 seconds ago.)Txtodd.com (43 seconds ago.)

Recently Searched Keywords

btn (2 seconds ago.)331pxleft (2 seconds ago.)luftreiniger (3 seconds ago.)googly eyes pictures clip art (7 seconds ago.)09 (7 seconds ago.)du lịch hạ long 2 ngày 1 đêm (ngủ khách sạn) (9 seconds ago.)industrial manufacturing (10 seconds ago.)0in (12 seconds ago.)du lịch hè vùng miển (14 seconds ago.)emlak vergisinde vergi ziyaı cezası hesaplama (16 seconds ago.)embed (22 seconds ago.)brawl stars популярная экшен стрелялка от supercell с уникальными онлайн режимами. (23 seconds ago.)brooklyn, ny (24 seconds ago.)22 2017 (25 seconds ago.)btn-outline-light navbarbtncreatelistingremoveclassaddclassbtn btn-block (26 seconds ago.)софия (27 seconds ago.)023 (28 seconds ago.)panel (29 seconds ago.)brawl stars популярная экшен стрелялка от supercell с уникальными онлайн режимами. (30 seconds ago.)huisje (32 seconds ago.)vivian maier (32 seconds ago.)athlone town centre voucher (32 seconds ago.)2iuvk (33 seconds ago.)iron horse trail tunnel (35 seconds ago.)all 015s linear (36 seconds ago.)gorakhpur (38 seconds ago.)zrich (40 seconds ago.)offset-druck (40 seconds ago.)space weather (41 seconds ago.)thoroughly (42 seconds ago.)