Singapore Press Holdings - SPH Digital & Home Delivery Subscriptions

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: 52,470
Estimated Worth: $40,500
Last updated:2020-10-24
Category: News and Media

SPH's core business is publishing of newspapers and magazines in both ✔print and ✔digital editions. Subscribe today & enjoy unlimited access.


Domain summary

Domain label
sph
Domain extension
com.sg
Global Traffic Rank
52,470
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$40,500
Estimated daily income
$75
Estimated monthly income
$2,281

Rank summary

How is sph.com.sg ranked relative to other sites:

Percentage of visits to sph.com.sg from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sph.com.sg registered?
A: Sph.com.sg was registered 2021 years, 2 months, 3 weeks, 4 days, 7 hours, 59 minutes, 35 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Sph.com.sg last updated?
A: The WHOIS entry was last updated 2021 years, 2 months, 3 weeks, 4 days, 7 hours, 59 minutes, 35 seconds ago on Monday, November 30, -0001.
Q: What are Sph.com.sg's nameservers?
A: DNS for Sph.com.sg is provided by the following nameservers:
  • ns-133.awsdns-16.com
  • ns-1524.awsdns-62.org
  • ns-1819.awsdns-35.co.uk
  • ns-551.awsdns-04.net
Q: Who is the registrar for the Sph.com.sg domain?
A: The domain has been registered at .
Q: What is the traffic rank for Sph.com.sg?
A: Sph.com.sg ranks 52,470 globally on Alexa. Sph.com.sg has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Sph.com.sg each day?
A: Sph.com.sg receives approximately 6,684 visitors and 26,736 page impressions per day.
Q: What IP address does Sph.com.sg resolve to?
A: Sph.com.sg resolves to the IPv4 address 202.27.31.36.
Q: In what country are Sph.com.sg servers located in?
A: Sph.com.sg has servers located in the Singapore.
Q: What webserver software does Sph.com.sg use?
A: Sph.com.sg is powered by webserver.
Q: Who hosts Sph.com.sg?
A: Sph.com.sg is hosted by 1000 Toa Payoh North, News Centre in Singapore, Singapore, Singapore, 179431.
Q: How much is Sph.com.sg worth?
A: Sph.com.sg has an estimated worth of $40,500. An average daily income of approximately $75, which is roughly $2,281 per month.

Sph.com.sg Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sph.com.sg Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sph.com.sg

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sph.com.sg

titlemodifyecsharehrefid textecsharehrefidsubstring9 var ecsharetitletitlemodifyecsharehrefidbusinessmodifyecsharehrefidsphaonclick functiongacustomeventquickclicknowcomponentnoneenjoytabletaonclickthisattrid varstraits timesharianjqueryappdownloadlinkcssdisplaymodifyecsharehrefid ecsharehrefidsubstring9 varthisattridvar modifyecsharehrefid ecsharehrefidsubstring9var ecsharetitle titlemodifyecsharehrefidsubscriptionsfm 893thisattrid var modifyecsharehrefidberita harianonesingaporejquerystoredownloadlinkcssdisplaynewlianheecsharehrefid thisattridtimes the businessappthisattrhreflistenfunctiongacustomeventquickecsharehrefidsubstring9 varaonclick functiongacustomeventquick links1fmfunctionvarlianhe zaobaonewsfunctionvar ecsharehrefid thisattridreadmall0rewardsaccessclick thisattrhrefpersonalfunctiongacustomeventdynamic componentecsharehrefidbusiness timesecsharetitletextvar modifyecsharehrefidfunctiongacustomeventdynamicgacustomeventevent sharegetvar ecsharetitlezaobaofunctiongacustomeventradiolinksecsharetitle titlemodifyecsharehrefidstraitsmoneytext gacustomeventevent shareblockradiomodifyecsharehrefid ecsharehrefidsubstring9timesgacustomeventeventsharefunctiontitlemodifyecsharehrefid text gacustomeventeventmoney fmecsharehrefid thisattrid varfunctiongacustomeventquick linksjquerythisattrhreftext gacustomeventeventberitanewspapersifgetmobileoperatingsystemecsharetitle titlemodifyecsharehrefid textmagazinesmoney fm 893ecsharehrefidsubstring9varfunctionvar ecsharehrefid

Longtail Keyword Density for Sph.com.sg

KeywordsOccurences
functionvar ecsharehrefid thisattrid6
ecsharehrefid thisattrid var6
thisattrid var modifyecsharehrefid6
var ecsharetitle title-modifyecsharehrefid6
ecsharetitle title-modifyecsharehrefid text6
title-modifyecsharehrefid text gacustomeventevent6
text gacustomeventevent share6
aonclick functiongacustomeventquick links4
var modifyecsharehrefid ecsharehrefidsubstring94
modifyecsharehrefid ecsharehrefidsubstring9 var4
ecsharehrefidsubstring9 var ecsharetitle4
times the business3
money fm 8933
thisattrid var9
text gacustomeventevent7
title-modifyecsharehrefid text6
ecsharetitle title-modifyecsharehrefid6
var ecsharetitle6
var modifyecsharehrefid6
ecsharehrefid thisattrid6
functionvar ecsharehrefid6
gacustomeventevent share6
business times4
functiongacustomeventquick links4
aonclick functiongacustomeventquick4
modifyecsharehrefid ecsharehrefidsubstring94
ecsharehrefidsubstring9 var4
berita harian4
straits times4
click thisattrhref3
functiongacustomeventdynamic component3
fm 8933
money fm3
lianhe zaobao3
var20
text12
ecsharetitle12
sph11
functionvar11
thisattrid9
times8
jquerythisattrhref8
gacustomeventevent7
fm6
title-modifyecsharehrefid6
modifyecsharehrefid6
ecsharehrefid6
share6
thisattrhref5
subscriptions5
rewards5
lianhe5
listen5
none4
aonclick4
functiongacustomeventquick4
links4
new4
radio4
get4
jquerystoredownloadlinkcssdisplay4
harian4
berita4
business4
ecsharehrefidsubstring94
straits4
jqueryappdownloadlinkcssdisplay4
block4
ifgetmobileoperatingsystem4
now4
click4
magazines4
singapore4
read4
newspapers3
03
one3
mall3
zaobao3
news3
component3
personal3
enjoy3
money3
functiongacustomeventdynamic3
access3
functiongacustomeventradio3
tablet3
app3
function3
13

Who hosts Sph.com.sg?

Sph.com.sg Hosting Provider Information

Hosted IP Address:202.27.31.36
Hosted Hostname:202.27.31.36
Service Provider:1000 Toa Payoh North, News Centre
Hosted Country:SingaporeSG
Location Latitude:1.28967
Location Longitude:103.85
Webserver Software:Not Applicable

Is "1000 Toa Payoh North, News Centre" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
1000 Toa Payoh North, News Centre
0.0003%

HTTP Header Analysis for Sph.com.sg

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 24 Oct 2020 20:54:14 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 231
Connection: keep-alive
Server: WEB
X-Frame-Options: SAMEORIGIN
Location: https://www.sph.com.sg/

Sph.com.sg Domain Nameserver Information

HostIP AddressCountry
ns-133.awsdns-16.com 205.251.192.133
ns-1524.awsdns-62.org 205.251.197.244
ns-1819.awsdns-35.co.uk 205.251.199.27
ns-551.awsdns-04.net 205.251.194.39


Need to find out who hosts Sph.com.sg?


Domain Registration (WhoIs) information for Sph.com.sg

 ----------------------------------------------------------------------
SGNIC WHOIS Server
----------------------------------------------------------------------

The following data is provided for information purposes only.

Registrar: CSC CORPORATE DOMAINS INC

Domain Name: SPH.COM.SG
Creation Date: 01-Apr-1995 00:00:00
Modified Date: 17-Apr-2020 17:30:44
Expiration Date: 01-Apr-2021 00:00:00
Domain Status: OK
Domain Status: CLIENT TRANSFER PROHIBITED
Domain Status: [email protected] Required

Registrant:

Name: SINGAPORE PRESS HOLDINGS LIMITED (SGNIC-ORG1005940)


Administrative Contact:

Name: SINGAPORE PRESS HOLDINGS LIMITED (SGNIC-ORG1005940)


Technical Contact:

Name: SINGAPORE PRESS HOLDINGS LTD (SGNIC-ORG1005941)
Email: Login to show email
Servers:
NS-133.AWSDNS-16.COM
NS-551.AWSDNS-04.NET
NS-1819.AWSDNS-35.CO.UK
NS-1524.AWSDNS-62.ORG


DNSSEC:
unsigned

Websites with Similar Names

Sph-55.com
SUPER 8
Sph-analytics.org
Error 404 (Not Found)!!1
Sph-model.com
SPH – model agency
Sph-nv.ru
Äîáðî ïîæàëîâàòü ïèòîìíèê Murashoff! - Канадские Сфинксы - Питомник MURASHOFF!
Sph-photo.com
Photography Services - Images that Inspire - River Town Photography
Sph-polyester.com
SPH Polyester
Sph-sentul.net
Sentul City
Sph-service.com
SPH Service Propreté Hygiène.
Sph-tartous.com
نقابة صيادلة سوريا فرع طرطوس

Recently Updated Websites

Nebmist.org (1 second ago.)Poetika.press (1 second ago.)108foto.pro (3 seconds ago.)Iloveubabe.org (3 seconds ago.)Keukenhuis-lemmer.online (4 seconds ago.)Teocollege.org (5 seconds ago.)Petzen-in-essen.ruhr (6 seconds ago.)Shoppaign.org (6 seconds ago.)Kazino-s-minimalnym-depozitom1.online (6 seconds ago.)Smkmutiara1bdg.online (12 seconds ago.)Jessrodierdigital.solutions (12 seconds ago.)21dayvideoadschallenge.org (14 seconds ago.)Shopzones.org (14 seconds ago.)Krisapps.online (15 seconds ago.)Bchep.org (16 seconds ago.)Lickmypussy.org (16 seconds ago.)Slecht-slapen.online (16 seconds ago.)Armenianfunds.org (17 seconds ago.)Variousbrands.online (18 seconds ago.)Halloweengraveyard.shop (21 seconds ago.)Nicoleandwestleigh.party (21 seconds ago.)Theappgrade.org (24 seconds ago.)Biner.org (26 seconds ago.)Midlandlegacyboosters.org (29 seconds ago.)Midlandlegacyrebelsathletics.org (29 seconds ago.)Mobilityfacility.org (29 seconds ago.)Idje.shop (30 seconds ago.)Gronninvestor.online (31 seconds ago.)Pediatrikbakis.org (32 seconds ago.)Gieldarolnicza.online (32 seconds ago.)

Recently Searched Keywords

slon (1 second ago.)choo choo train(type-ex) exile(choo choo train(type-ex),choo choo train(type-ex)歌曲,choo choo train(type-ex)mp3,choo choo train(t (2 seconds ago.)us visible satellite (4 seconds ago.)what are the spiritual benefits of blessing israel (5 seconds ago.)optik ve elektronik ürünler (7 seconds ago.)200rsvp card double (9 seconds ago.)incidental and conducive (19 seconds ago.)second (23 seconds ago.)alabaster stone (23 seconds ago.)afternoons (26 seconds ago.)sol et (30 seconds ago.)hard money loans (33 seconds ago.)technical management (35 seconds ago.)ekmek çeşitleri (35 seconds ago.)سی ان ان cnn (37 seconds ago.)venu sq (41 seconds ago.)trusted tablets (41 seconds ago.)网易云音乐 网易旗下的高品质音乐播放器 (43 seconds ago.)iheartnaptime bread (46 seconds ago.)centerbackground-attachment scrollbackground-sizecoverbackground-repeatno-repeatmedia screen (53 seconds ago.)open web design (58 seconds ago.)риолэнд (1 minute ago.)ifreturnuser (1 minute 4 seconds ago.)0 13257 scroll (1 minute 6 seconds ago.)brightonframing (1 minute 10 seconds ago.)pprc polypropylene random copolymer (1 minute 17 seconds ago.)20px transform none (1 minute 19 seconds ago.)lương-quyền lợi và trách nhiệm của hộ lý, điều dưỡng đi làm việc tại đài loan (1 minute 19 seconds ago.)güneş enerji haritası (1 minute 21 seconds ago.)pdb format guide (1 minute 23 seconds ago.)