Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-03-18
Domain label
spor-d
Domain extension
net
Domain registered:
2020-01-22
Domain updated:
2021-01-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Spor-d.net registered?
A: Spor-d.net was registered 1 year, 11 months, 3 weeks, 5 days, 23 hours, 30 minutes, 37 seconds ago on Wednesday, January 22, 2020.
Q: When was the WHOIS for Spor-d.net last updated?
A: The WHOIS entry was last updated 11 months, 3 weeks, 5 days, 23 hours, 30 minutes, 37 seconds ago on Friday, January 22, 2021.
Q: What are Spor-d.net's nameservers?
A: DNS for Spor-d.net is provided by the following nameservers:
  • ns49.domaincontrol.com
  • ns50.domaincontrol.com
Q: Who is the registrar for the Spor-d.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Spor-d.net?
A: Spor-d.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Spor-d.net each day?
A: Spor-d.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Spor-d.net resolve to?
A: Spor-d.net resolves to the IPv4 address 34.102.136.180.
Q: In what country are Spor-d.net servers located in?
A: Spor-d.net has servers located in the United States.
Q: What webserver software does Spor-d.net use?
A: Spor-d.net is powered by Openresty webserver.
Q: Who hosts Spor-d.net?
A: Spor-d.net is hosted by GOOGLE in Missouri, Kansas City, United States, 64121.
Q: How much is Spor-d.net worth?
A: Spor-d.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Spor-d.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Spor-d.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Spor-d.net

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Who hosts Spor-d.net?

Spor-d.net Hosting Provider Information

Hosted IP Address:34.102.136.180
Hosted Hostname:180.136.102.34.bc.googleusercontent.com
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:39.1027
Location Longitude:-94.5778
Webserver Software:openresty

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%

HTTP Header Analysis for Spor-d.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Thu, 18 Mar 2021 18:00:36 GMT
Content-Type: text/html
Content-Length: 2522
Last-Modified: Wed, 17 Mar 2021 23:53:21 GMT
ETag: "60529671-9da"
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAJRmzcpTevQqkWn6dJuX/N/Hxl7YxbOwy8 73ijqYSQEN WGxrruAKtZtliWC86 ewQ0msW1W8psOFL/b00zWqsCAwEAAQ_auVbIWck91De0dlZE63K5DH0xL5W/yCSTC6R 8PL0XJia7UIP3AgjLY1sCU6BzX8mMrDkxozCGtmYh70J1ECMg
Accept-Ranges: bytes
Via: 1.1 google

Spor-d.net Domain Nameserver Information

HostIP AddressCountry
ns49.domaincontrol.com 97.74.104.25
ns50.domaincontrol.com 173.201.72.25


Need to find out who hosts Spor-d.net?


Domain Registration (WhoIs) information for Spor-d.net

 Domain Name: SPOR-D.NET
Registry Domain ID: 2483252299_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-01-22T12:11:57Z
Creation Date: 2020-01-22T04:56:48Z
Registry Expiry Date: 2022-01-22T04:56:48Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS49.DOMAINCONTROL.COM
Name Server: NS50.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-03-18T18:00:29Z

Websites with Similar Names

Spor-borsasi.com
Spor Borsas?
Spor-e.com
spor-e.com – ??????????.com??????????
Spor-fitwell.com
spor-fitwell.com - spor fitwell Resources and Information.
Spor-giris.com
spor-giris.com
Spor-haberleri.net
AEKlı forvet Marko Livaja serbest kaldı!
Spor-hukuk-almanya.com
Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat Almanya spor hukuku avukat

Recently Updated Websites

Ptgperm.com (5 seconds ago.)Theoldfurnitureguys.com (10 seconds ago.)Maddie-stambler.com (10 seconds ago.)Polsonpedals.com (13 seconds ago.)Peterroyal.com (14 seconds ago.)Dcolehairdesign.com (15 seconds ago.)Synergy1hosting.com (16 seconds ago.)Authorllfranklin.com (18 seconds ago.)Lyonranch.com (19 seconds ago.)Yibovip7940.com (19 seconds ago.)Gagvr.com (19 seconds ago.)Bargainhunters.center (20 seconds ago.)Jutapol.com.pl (22 seconds ago.)Stonebridgefarm.com (23 seconds ago.)68520s.com (24 seconds ago.)Spraypaintandinkpens.com (24 seconds ago.)Rose.pub (25 seconds ago.)Warwicklodgecarlisle.co.uk (26 seconds ago.)Zeevest.com (27 seconds ago.)Sierramedicalsupport.net (27 seconds ago.)By433.vip (28 seconds ago.)Aboutunicorns.com (28 seconds ago.)Nfea.org.uk (28 seconds ago.)Blackbirdlearningassociates.com (28 seconds ago.)Suboticsltd.com (29 seconds ago.)Liquidsilverpublishing.com (29 seconds ago.)Archeryinthewild.com (30 seconds ago.)Myfloridahistory.org (30 seconds ago.)Hotelsunsetinn.com (47 seconds ago.)Traderchamps.com (48 seconds ago.)

Recently Searched Keywords

name g cookiedomain (1 second ago.)important is-form-id-241725 (1 second ago.)футбол сегодня лига чемпионов (2 seconds ago.)watch q8 (2 seconds ago.)waterproof boxes bunnings (4 seconds ago.)unfallwagenankauf bad münder am deister (6 seconds ago.)truckersmp kurulum rehberi (11 seconds ago.)s-nav-linotselected s-nav-icons icss-1kabyu3 (12 seconds ago.)khởi tố 2 nghi phạm sát hại, cướp tài sản nữ sinh học viện ngân hàng (14 seconds ago.)beanys seite (15 seconds ago.)vdbckn (18 seconds ago.)post-meta authordgbmblogmodule6dgbmblogmodule (20 seconds ago.)fate the winx saga (21 seconds ago.)дамски спортни обувки eusebia черни (21 seconds ago.)pierre cardin ipek eşarp (22 seconds ago.)překladatelsk (24 seconds ago.)classad-containeru003enu003camp-adnwidth300nheight250ntypedoubleclickndata-slot3162989pointemagazinepmamp300x250u003enu003camp-adu003eu003cdivu003e order 5 (29 seconds ago.)adwidth (29 seconds ago.)aspect ratio 43 (30 seconds ago.)vin xy dng (31 seconds ago.)..contact us.. (31 seconds ago.)sandal office ladies (32 seconds ago.)dieutriviemloetdaday (35 seconds ago.)2019 reading sats (36 seconds ago.)282828 important (38 seconds ago.)kabar kudus (38 seconds ago.)s2 ep23: old and new (39 seconds ago.)soyo wins 2nd cambodian ict awards 2018 and the best digital content 2018 award (40 seconds ago.)gerbera bouquet meaning (41 seconds ago.)artesanallinktargetblanktypewixdatapageidz3ykjtargetselftypepagelinkpagenamecerveza artesanalsourcenameprivatetagsfileoriginuploadedheight2704width1920filenamecerveza andes (43 seconds ago.)