Srimatriniketanashram.org Favicon Srimatriniketanashram.org

Srimatriniketanashram.org Website Thumbnail
Checking...
Welcome To Sri Matriniketan Ashram Sri Aurobindo Centre
Low trust score
Add a review Change category Claim this site
Sri Matriniketan Ashram Sri Aurobindo Centre


Domain summary

Domain label
srimatriniketanashram
Domain extension
org
Domain registered:
2009-09-24
Domain updated:
2020-09-29
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is srimatriniketanashram.org ranked relative to other sites:

Percentage of visits to srimatriniketanashram.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Srimatriniketanashram.org registered?
A: Srimatriniketanashram.org was registered 11 years, 3 weeks, 5 days, 9 hours, 40 minutes, 59 seconds ago on Thursday, September 24, 2009.
Q: When was the WHOIS for Srimatriniketanashram.org last updated?
A: The WHOIS entry was last updated 3 weeks, 9 hours, 40 minutes, 59 seconds ago on Tuesday, September 29, 2020.
Q: What are Srimatriniketanashram.org's nameservers?
A: DNS for Srimatriniketanashram.org is provided by the following nameservers:
  • ns1.superappscloud.com
  • ns2.superappscloud.com
Q: Who is the registrar for the Srimatriniketanashram.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Srimatriniketanashram.org?
A: Srimatriniketanashram.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Srimatriniketanashram.org each day?
A: Srimatriniketanashram.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Srimatriniketanashram.org resolve to?
A: Srimatriniketanashram.org resolves to the IPv4 address 198.24.151.139.
Q: In what country are Srimatriniketanashram.org servers located in?
A: Srimatriniketanashram.org has servers located in the United States.
Q: What webserver software does Srimatriniketanashram.org use?
A: Srimatriniketanashram.org is powered by Apache webserver.
Q: Who hosts Srimatriniketanashram.org?
A: Srimatriniketanashram.org is hosted by SECURED SERVERS LLC in Arizona, Phoenix, United States, 85001.
Q: How much is Srimatriniketanashram.org worth?
A: Srimatriniketanashram.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Srimatriniketanashram.org?

Srimatriniketanashram.org Hosting Provider Information

Hosted IP Address:198.24.151.139
Hosted Hostname:gains.superappscloud.com
Service Provider:SECURED SERVERS LLC
Hosted Country:United StatesUS
Location Latitude:33.4532
Location Longitude:-112.0749
Webserver Software:Apache

Is "SECURED SERVERS LLC" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Srimatriniketanashram.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 29 Sep 2020 02:17:03 GMT
Server: Apache
X-Powered-By: PHP/5.6.40
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 18142
Content-Type: text/html; charset=UTF-8

Srimatriniketanashram.org Domain Nameserver Information

HostIP AddressCountry
ns1.superappscloud.com 198.24.151.140
ns2.superappscloud.com 198.24.151.141


Need to find out who hosts Srimatriniketanashram.org?


WhoIs information for Srimatriniketanashram.org

 Domain Name: SRIMATRINIKETANASHRAM.ORG
Registry Domain ID: D157184139-LROR
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2017-09-23T14:43:55Z
Creation Date: 2009-09-24T18:13:18Z
Registry Expiry Date: 2020-09-24T18:13:18Z
Registrar Registration Expiration Date:
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: matriniketan
Registrant State/Province: Orissa
Registrant Country: IN
Name Server: NS1.SUPERAPPSCLOUD.COM
Name Server: NS2.SUPERAPPSCLOUD.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-30T04:56:20Z

Srimatriniketanashram.org Free SEO Report

Website Inpage Analysis for Srimatriniketanashram.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

33:
  1. The World Hindu WISDOM MEET-2014
    http://srimatriniketanashram.org/WHWM_2014.php
  2. The World Hindu Summit-II
    http://srimatriniketanashram.org/WHS_II.php
  3. Why Sri Matriniketan Ashram
    http://srimatriniketanashram.org/Sri_Matriniketan_Ashram.php
  4. Sri Matri (dhyana) Mandir
    http://srimatriniketanashram.org/SriMatrimandir.php
  5. Ashram
    http://srimatriniketanashram.org/index.php
  6. Objective
    http://srimatriniketanashram.org/Objective.php
  7. Integral Yoga
    http://srimatriniketanashram.org/Integral_Yoga.php
  8. Research
    http://srimatriniketanashram.org/Research_Paper.php
  9. Journal
    http://srimatriniketanashram.org/Journal.php
  10. Education
    http://srimatriniketanashram.org/Education.php
  11. Contact
    http://srimatriniketanashram.org/TheCall.php
  12. a liberated universalized individual Soul Centre
    http://srimatriniketanashram.org/Documents/Change April - 2019/Soul Centre-24.04.pdf
  13. Integral Karma Yoga
    http://srimatriniketanashram.org/Documents/Change-April-2018/Karma Yoga.pdf
  14. Integral Jnana Yoga
    http://srimatriniketanashram.org/Documents/Change-April-2018/Jnana Yoga.pdf
  15. Integral Bhakti Yoga
    http://srimatriniketanashram.org/Documents/Change-April-2018/Bhakti Yoga.pdf
  16. Integral Yoga of Self-Perfection
    http://srimatriniketanashram.org/Documents/Change-April-2018/Yoga of Self-Perfection.pdf
  17. Supramental Yoga
    http://srimatriniketanashram.org/Documents/Change-August-2018/Supramental Yoga.pdf
  18. Integral Yoga
    http://srimatriniketanashram.org/Documents/Change March-2015/Main Frame of Integral Yoga.pdf
  19. Integral Knowledge
    http://srimatriniketanashram.org/Documents/Change-April-2016/Seven-fold Integral Knowledge.pdf
  20. June Yoga Sadhana Camp-2020
    http://srimatriniketanashram.org/Documents/Change August-2020/Yoga Sadhana Camp-June-2020-final.pdf
  21. Sri Matriniketan Ashram Report-2020
    http://srimatriniketanashram.org/Documents/Change April-2020/Sri Matriniketan Ashram Report-01.02.2020.pdf
  22. June Yoga Sadhana Camp-2019
    http://srimatriniketanashram.org/Documents/Change August - 2019/Yoga Sadhana Camp-June-2019 _revised_.pdf
  23. Ashram Report-2019
    http://srimatriniketanashram.org/Documents/Change March-2019/Ashram Report-01.02..2019.pdf
  24. June Yoga Sadhana Camp-2018
    http://srimatriniketanashram.org/Documents/Change-August-2018/Yoga Sadhana Camp-June-2018.pdf
  25. Ashram Report-2018
    http://srimatriniketanashram.org/Documents/Change-March-2018/Sri Matriniketan Ashram Report-01.02.pdf
  26. June Yoga Sadhana Camp-2017
    http://srimatriniketanashram.org/Documents/Change-July-2017/Yoga Sadhana Camp-June-2017.pdf
  27. Ashram Report-2017
    http://srimatriniketanashram.org/Documents/Change-February-2017/Revised Sri Matriniketan Ashram Report-2017.pdf
  28. June Yoga Sadhana Camp-2016
    http://srimatriniketanashram.org/Documents/Change-June-2016/June Sadhana Camp-2016 -Revised.pdf
  29. Ashram Report-2016
    http://srimatriniketanashram.org/Documents/Change-March-2016/Sri Matriniketan Ashram Report-2016.pdf
  30. June Yoga Sadhana Camp-2015
    http://srimatriniketanashram.org/Documents/Change-April-2017/June Sadhana Camp-2015 .pdf
  31. Ashram Report-2015
    http://srimatriniketanashram.org/Documents/Change March-2015/Sri Matriniketan Ashram Report-2015.pdf
  32. No text
    http://srimatriniketanashram.org/Documents/Change July-2015/June Sadhana Camp-2015 .pdf
  33. download
    http://srimatriniketanashram.org/Documents/Change August-2020/Ashram.pdf

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Srimatriniketanashram.org

hethinggreatmovementcallpowerholdingknowledgesoulsexperienceappearanceallnbsp june yogacwsa23the synthesistheirignorancealsodivine in allconsciousegonbsp junebeingsthemrelationsselfhis owndiscordnaturersquoscosmic consciousnessawarenessrealisedfieldwhollylimitcollectivitycommunitythroughdownholding backproposedphysicalawarethesesriimmenseeternalprogressiverealiseatmosphereintoharmonymentaltransformedsuccession of momentsactivefalseperiodearthsachchidanandaagainstecstasyaccordinggoodexclusiveuniverseloveworldtype of liberatedperfectuniondifficult taskwholegroupitssubtleimpersonaljnanano longerformsbodiesperfectiontaskformlessspaceluminousbirthashramcreationhas notnewdiscordsforceforwardselfexpressionpossibilitiestimefreelyrealisationeternitynoactionsecondincludeshasaurobindocouldprocessmoretheythanbecomingcall downdivisibilityplaythoughtbrahmannbsp ashramnaturedifficultmutablelivessensebutbecomeexistencescosmicmanifestationpersonalitywhoseusproposed in integralothersright relationliberated individualequalformnbspbodycertain formsbeyonddivine workall ourlimitationworkeachtrueequalityhe hasdynamicfullidentityjune yoga sadhanaservicelastcentreblissrealityplastichimselfnaturalstillobjectiveiflimitinglightdiversitytransformationonenesslivejnana yogavesselmatriniketaninfiniteanymustdivine truthmenspiritspiritualbeatitudeperfectedorderishaharmonious diversityourselvesrightuniversalisedindividual soullawcollectivehigherall thingsessentialsubstancetherecomesinfluenceeveryevenmatterabsoluteactivitiesgnosticrelationnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsptheexistencefreedommankindnecessaryuniversalgreatestservepasscannotonlydevelopedprofoundmomentssri matriniketan ashramplanechangetotalexperiencesits ownstaticabovetruthsoul centresufferingapparentso that certaingetfiniteonevisionentiremanyenergybestlivingsuccessionwouldhislikeheartfixedthusbrought forwardultimateintimateleavinghuman mindsupremeindividual soul centrecalmsupramentalseekarmabecausetime and spacematriniketan ashrammanimperfectyoga sadhanayogaactivitycanunityharmoniousbackcertaincwsa23theactsoulraceincapacityownevilpartialsurroundingcreatehighestliberated soulthencompletesri aurobindointegral yoganbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspthenowworksuponforcestowardswithingodhumanemergesdescentbroughthumanitydisharmonywhichsoulrsquosmindsintegralmindwrongdivineall beingswithoutnot onlyjuneconsciousnessindividual egogivestranscendentimmortalitysadhanabeautynothingwisdomthingspropercreaturesfoundationlifeprincipleall lifesri matriniketanmostdivinelyjune yoganotboundsynthesisextensionspace and timejoyfreebeingsooutitselfthrough whichdelightlongpermanentliberatedstateobstacleothercontactlongerreasonevolutionoriginalinneracceptshimmaterialweindividualuniversalityinfinitelyourrangevirginmost difficulttypelimited

Longtail Keyword Density for Srimatriniketanashram.org

KeywordsOccurences
proposed in integral10
june yoga sadhana6
so that certain5
nbsp june yoga5
sri matriniketan ashram4
individual soul centre4
time and space4
space and time3
divine in all3
succession of moments3
type of liberated3
its own8
integral yoga7
all things7
individual soul6
right relation6
yoga sadhana6
june yoga6
all beings6
holding back6
soul centre6
all life5
he has5
nbsp june5
difficult task5
has not4
cwsa23the synthesis4
matriniketan ashram4
brought forward4
sri matriniketan4
through which3
cosmic consciousness3
his own3
individual ego3
human mind3
divine truth3
certain forms3
all our3
not only3
harmonious diversity3
jnana yoga3
liberated individual3
call down3
liberated soul3
most difficult3
no longer3
divine work3
sri aurobindo3
nbsp ashram3
all73
divine61
his47
its45
consciousness44
life37
which35
individual30
he29
world28
soul26
not25
yoga24
spiritual24
being22
nature22
would21
knowledge21
integral20
mind20
into20
through19
universal19
truth19
centre18
things18
existence18
can17
action17
our17
relation15
so15
proposed15
nbsp14
one14
self14
ashram13
infinite13
time13
space13
we13
force13
oneness13
own13
their12
human12
cosmic12
man12
conscious12
must12
liberated12
eternal12
there12
supramental12
ego12
but12
itself11
right11
power11
out11
has11
collective10
manifestation10
more10
only10
sense10
without10
movement10
most10
play10
back10
earth10
if9
synthesis9
unity9
himself9
because9
difficult9
light9
order9
mental9
god9
supreme8
beings8
other8
sri8
certain8
no8
harmony8
perfect8
material8
evolution8
reality8
limited7
us7
within7
harmonious7
forms7
change7
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspthe7
greatest7
sadhana7
task7
dynamic7
towards7
matter7
delight7
even7
luminous7
ignorance7
forces6
whole6
humanity6
universe6
influence6
become6
transcendent6
holding6
souls6
highest6
new6
spirit6
brahman6
diversity6
creation6
limitation6
universality6
june6
cannot6
creatures6
them6
true6
experience6
perfection5
each5
good5
foundation5
best5
freedom5
essential5
work5
incapacity5
suffering5
lives5
activity5
now5
absolute5
beyond5
down5
state5
field5
complete5
moments5
law5
collectivity5
heart5
living5
body5
free5
subtle5
others4
finite4
relations4
substance4
freely4
race4
transformation4
realisation4
vision4
forward4
brought4
then4
matriniketan4
limiting4
equality4
community4
divinely4
long4
full4
partial4
wrong4
gnostic4
group4
could4
form4
thought4
men4
naturersquos4
nothing4
create4
discord4
physical4
love4
jnana4
contact4
union4
bound4
extension4
bliss4
wisdom4
total4
cwsa23the4
period4
serve4
transformed4
upon4
evil4
than4
energy4
live4
isha4
service4
becoming4
universalised4
descent3
static3
experiences3
gives3
soulrsquos3
second3
limit3
includes3
necessary3
plane3
exclusive3
personality3
type3
succession3
aurobindo3
self-expression3
obstacle3
whose3
virgin3
principle3
surrounding3
fixed3
possibilities3
profound3
bodies3
eternity3
mankind3
minds3
many3
natural3
against3
comes3
permanent3
immense3
process3
perfected3
pass3
calm3
birth3
imperfect3
aware3
developed3
atmosphere3
divisibility3
identity3
objective3
active3
these3
vessel3
immortality3
call3
longer3
activities3
range3
entire3
karma3
leaving3
any3
wholly3
also3
every3
higher3
see3
thing3
progressive3
false3
formless3
ultimate3
realise3
impersonal3
emerges3
thus3
they3
intimate3
him3
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspthe3
ourselves3
above3
proper3
inner3
disharmony3
last3
appearance3
reason3
equal3
beauty3
mutable3
great3
accepts3
original3
existences3
beatitude3
works3
ecstasy3
apparent3
get3
infinitely3
awareness3
discords3
act3
sachchidananda3
still3
joy3
realised3
according3
like3
plastic3

Srimatriniketanashram.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Srimatriniketanashram.org is a scam?

Websites with Similar Names

Srimaatha.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Srimaatha.org
SRIMAATHA.ORG
Srimad.org
Srimad Bhagavatham
Srimadbhagavadgita.net
Srimad Bhagavad Gita in English | Gosai Publishers
Srimadbhagavatam.org
Srimad Bhagavatam (Bhagavata Purana); the story of Krishna
Srimadbhagwatgeeta.com
葡亰网络赌场_新葡亰注册网址_www1545com
Srimadhurainn.com
srimadhurainn.com
Srimag.com
ABCの秘密
Srimaging.com
SRI Is Now A GPRS Company - Ground Penetrating Radar Systems - GPRS LLC
Srimahabodhi.lk
SRI MAHA BODHI – Official Web Site of Maha Viharaya, Anuradhapura, Sri Lanka

Recently Updated Websites

Megarawmelts.com 1 second ago.Mediaone.com 2 seconds ago.Smartforex.org 2 seconds ago.Sanfordeducationcenter.org 2 seconds ago.Gobars.ru 2 seconds ago.German-herbs.com 3 seconds ago.Onebluebird.com 3 seconds ago.Pibamec.com 4 seconds ago.Chronosmeetings.com 5 seconds ago.Realbatreviews.com 5 seconds ago.Buenvivir.co 5 seconds ago.39547jy.com 5 seconds ago.Strupptrucking.com 6 seconds ago.Eurekakids.fr 6 seconds ago.Internationaltaekwondounion.com 7 seconds ago.Willway-saiyou.net 7 seconds ago.Sardegnaphototour.com 8 seconds ago.Internetmarketingkings.com 8 seconds ago.Ylsgtjzcl.com 8 seconds ago.Iamdooser.org 8 seconds ago.Bibliotekacyfrowa.pl 8 seconds ago.Cmg-lifestyles.com 9 seconds ago.Tylerbridge.com 9 seconds ago.Trojanfamilynetwork.com 9 seconds ago.Bethelstpaul.com 10 seconds ago.Wakefieldfund.com 10 seconds ago.Petrooeste.com 10 seconds ago.9chords.com 10 seconds ago.Www-07.ibm.com 11 seconds ago.Uchastki.msk.ru 11 seconds ago.