Станислав.ру

Safety: Low trust score
Year Founded: 2005
Global Traffic Rank: Unknown
Estimated Worth: $9

Веб-сайт ручной работы, выросший из когда-то невзрачной и даже ужасной домашней странички в нечто более или менее приличное. Будучи когда-то сугубо личным произведением его автора, теперь он наполняется и развивается целым творческим коллективом, состоящим из друзей и знакомых, объединённых общей целью – через своё собственное творчество, самовы...



Domain summary

Last updated
2021-03-09
Domain label
stanislaw
Domain extension
ru
Domain registered:
2005-03-16
Domain updated:
2021-03-09
Domain expires:
2022-03-16
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is stanislaw.ru ranked relative to other sites:

Percentage of visits to stanislaw.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Stanislaw.ru registered?
A: Stanislaw.ru was registered 16 years, 1 month, 2 days, 17 hours, 44 minutes, 48 seconds ago on Wednesday, March 16, 2005.
Q: When was the WHOIS for Stanislaw.ru last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 2 days, 17 hours, 44 minutes, 48 seconds ago on Tuesday, March 9, 2021.
Q: What are Stanislaw.ru's nameservers?
A: DNS for Stanislaw.ru is provided by the following nameservers:
  • ns1.1gb.ru
  • ns2.1gb.ru
  • ns3.1gb-ru.com
Q: Who is the registrar for the Stanislaw.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Stanislaw.ru?
A: Stanislaw.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Stanislaw.ru each day?
A: Stanislaw.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Stanislaw.ru resolve to?
A: Stanislaw.ru resolves to the IPv4 address 81.177.174.9.
Q: In what country are Stanislaw.ru servers located in?
A: Stanislaw.ru has servers located in the Russia.
Q: What webserver software does Stanislaw.ru use?
A: Stanislaw.ru is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Stanislaw.ru?
A: Stanislaw.ru is hosted by OJSC RTComm.RU in Russia.
Q: How much is Stanislaw.ru worth?
A: Stanislaw.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Stanislaw.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Stanislaw.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Stanislaw.ru

H1 Headings

1 :
  1. Добро пожаловать, или Посторонним вход разрешён! :)

H2 Headings

16 :
  1. Задуматься
  2. Поучиться
  3. Развлечься
  4. Посмотреть
  5. Почитать
  6. Написать
  7. Об авторе
  8. О сайте
  9. …по-старому
  10. Новости сайта
  11. Последняя картинка
  12. Случайная статья
  13. Понравившееся видео
  14. Важная статья
  15. Случайный опрос
  16. Популярная страница

H3 Headings

4 :
  1. Активность посетителей
  2. Техника безопасности для одомашненных птиц
  3. Основные принципы и алгоритм гражданской активности
  4. Соционический тип: этико-сенсорный интроверт (хранитель) Теодор Драйзер

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

25 :

Google Adsense

:
pub-0290484562651509

Google Analytics

:
UA-8949525-1

Links - Internal

180:

Links - Internal (nofollow)

0:

Links - Outbound

13:

Links - Outbound (nofollow)

1:

Keyword Cloud for Stanislaw.ru

return1functionnbspwidthcontainermasonryreloadeldatahcurrlayoutlayoutcurrlayout fixeddocumentcreateelementscripttruenbsp nbsptisresizablefalsedetectcolwfixedelheightsearchbrickseldatah elheight0yandexcontainerinnerhtmlifspqrvarslidecolumnwidthheight

Who hosts Stanislaw.ru?

Stanislaw.ru Hosting Provider Information

Hosted IP Address:81.177.174.9
Hosted Hostname:81.177.174.9
Service Provider:OJSC RTComm.RU
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:Microsoft-IIS/8.5

Is "OJSC RTComm.RU" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
OJSC RTComm.RU
0.0387%

HTTP Header Analysis for Stanislaw.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Encoding: gzip
Content-Length: 19415
Content-Type: text/html; Charset=UTF-8
Date: Tue, 09 Mar 2021 06:45:25 GMT
Server: Microsoft-IIS/8.5
Vary: Accept-Encoding
X-Powered-By: ASP.NET

Stanislaw.ru Domain Nameserver Information

HostIP AddressCountry
ns1.1gb.ru 81.177.24.54
ns2.1gb.ru 195.161.112.91
ns3.1gb-ru.com 94.249.192.249


Need to find out who hosts Stanislaw.ru?


Domain Registration (WhoIs) information for Stanislaw.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: STANISLAW.RU
nserver: ns1.1gb.ru.
nserver: ns2.1gb.ru.
nserver: ns3.1gb-ru.com.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2005-03-16T21:00:00Z
paid-till: 2022-03-16T21:00:00Z
free-date: 2022-04-17
source: TCI

Last updated on 2021-03-09T06:36:34Z

Websites with Similar Names

Stani-fisch.de
Ihr Partner für Fisch seit 1971 | Online-Shop - Helmut Stanislaus GmbH
Stani.com
Children School Uniforms
Stani.page
Checkdomain Parking - www.stani.page
Stani.sh
403 - Forbidden
Stani.site
Children School Uniforms
Stani.us
Stani Henriques Projects | | I believe in hard work, amazing design & the power of great ideas.
Stani.xyz
stani.xyz - Registered at Namecheap.com

Recently Updated Websites

1171realty.com (1 second ago.)Checksandbalanceaccounting.com (1 second ago.)Narutohentaikonanhntaikonanhentaikonancheaper.work (2 seconds ago.)Prostitutki-mariupolya.win (2 seconds ago.)Clubcj.net (2 seconds ago.)Equation.info (3 seconds ago.)Bankiru.info (3 seconds ago.)Pikkustore.com (3 seconds ago.)Sh-boteng.com (3 seconds ago.)Grahapermatamandiri.com (3 seconds ago.)Richmondtownehome.com (3 seconds ago.)Skstyling.net (4 seconds ago.)Rwood.pl (5 seconds ago.)Zaccanet.com (6 seconds ago.)Sweetmeover.com (6 seconds ago.)Utcsigmachi.com (6 seconds ago.)Annals-general-psychiatry.com (6 seconds ago.)Snochef.com (6 seconds ago.)Torquesolutionscorp.com (6 seconds ago.)Philately.org (6 seconds ago.)Sanneskar.se (6 seconds ago.)168168xh.com (7 seconds ago.)1001tribu.com (7 seconds ago.)Dgkaike.com (7 seconds ago.)Healthieralternativebotanicals.com (7 seconds ago.)Agoranchess.com (7 seconds ago.)Yukataya-hiyori.com (7 seconds ago.)Iwolm.org (7 seconds ago.)Thesoutherngeneral.com (7 seconds ago.)00sq.cn (8 seconds ago.)

Recently Searched Keywords

markten (1 second ago.)pencil (1 second ago.)waterproof extreme cold (1 second ago.)pats (2 seconds ago.)Ñ�имфоничеÑ�кие концерты Ñ� учаÑ�тием мировых звезд (2 seconds ago.)gnler amp hijyen (4 seconds ago.)eroina tiara (4 seconds ago.)page-childrenpagesarrows (4 seconds ago.)unterhaltung (5 seconds ago.)kiwi education (5 seconds ago.)url url0 else (6 seconds ago.)memo (6 seconds ago.)contact us online for a free consultation (8 seconds ago.)important button-20114 (8 seconds ago.)0 dd321e (9 seconds ago.)customer supportn (10 seconds ago.)факультет дополнительного профессионального образования (фдпо) (13 seconds ago.)margin 0 height (14 seconds ago.)backlink checker (15 seconds ago.)la76810a ic price (17 seconds ago.)e27f08 0 (18 seconds ago.)económico (18 seconds ago.)0 d66f00 (21 seconds ago.)verlinkten seiten (23 seconds ago.)program parental (25 seconds ago.)tapez le (25 seconds ago.)huge (26 seconds ago.)bavurular bugn (26 seconds ago.)47 sales (27 seconds ago.)different types of scholarships (27 seconds ago.)