Staples.co.uk  |  Office Supplies, Furniture, Ink and Toner, Paper | Staples.co.uk
Low trust score  | 
Staples.co.uk offers over 11,000 products in office supplies, paper, ink and toner, furniture, coffee, soap, napkins, tissue and more. Order now for FAST, FREE shipping.

Staples.co.uk Website Information

Staples.co.uk has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 46,247, a Majestic Rank of 107,374, a Domain Authority of 55% and is not listed in DMOZ.

Staples.co.uk is hosted by COLT Technology Services Group Limited in France.
Staples.co.uk has an IP Address of 213.41.23.150 and a hostname of access-150.23.rev.fr.colt.net.

The domain staples.co.uk was registered 2 decades 3 years 2 months ago by , it was last modified 5 years 8 months 4 weeks ago and currently is set to expire 201 decades 9 years 1 day ago.


Whois information for staples.co.uk

Full Whois Lookup for Staples.co.uk Whois Lookup

Domain name:
staples.co.uk

Registrant:
Staples Europe B.V.

Registrant type:
Unknown

Registrant's address:
Hoogoorddreef 62
Amsterdam
ZO
1101 BE
Netherlands

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 09-May-2017

Registrar:
Markmonitor Inc. t/a MarkMonitor Inc. [Tag = MARKMONITOR]
URL: http://www.markmonitor.com

Relevant dates:
Registered on: before Aug-1996
Expiry date: 13-Feb-2018
Last updated: 01-Jun-2017

Registration status:
Registered until expiry date.

Name servers:
ns1.markmonitor.com
ns2.markmonitor.com
ns3.markmonitor.com
ns4.markmonitor.com
ns5.markmonitor.com
ns6.markmonitor.com
ns7.markmonitor.com

WHOIS lookup made at 16:33:46 18-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Staples.co.uk?

Staples.co.uk Web Server Information

Hosted IP Address:213.41.23.150
Hosted Hostname:access-150.23.rev.fr.colt.net
Service Provider:COLT Technology Services Group Limited
Hosted Country:FranceFR
Location Latitude:48.8534
Location Longitude:2.3488
Webserver Software:unknown

HTTP Header Analysis for Staples.co.uk

Http-Version: 1.0
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, no-store, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Vary: Accept-Encoding
COMMERCE-SERVER-SOFTWARE: Microsoft Commerce Server, Enterprise Edition
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-SID: PROD-04
X-Powered-By: ASP.NET
Content-Encoding: gzip
Date: Tue, 16 Jun 2015 02:35:01 GMT
Content-Length: 31148
Connection: close


Need to find out who hosts Staples.co.uk?

Staples.co.uk Free SEO Report

Website Inpage Analysis for Staples.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Staples.co.uk

pencookiesetcardscleaningcampaignlockupimgsrc campaignlockupdisplayreamelserangesavingscallout2youdataitembesttechnologypricesavingscallout1greyallsee all dealsnotebooks cardsseespeechbubbleborder white speechbubblebackgroundrangesavingscallout1ex vat packagewhiteboardsmailingrangesavingscallout3 rangepromocallouttextdrivesred campaignctabutton seerangelockupimgsrc rangelockupdisplaytypeelse ifchatavailableteachingyour business needscontactsopromocallouttextvatrangeproducttitle rangeproductpromoinfoeach qtyeachoutrangesavingscallout2bfalse varpapergifttitle productpromoinfobgallwhitereadcashskupriceperccampaigninfoapikeydesk accessoriescampaigntitlecolor greygettype campaign uniqueid1camerasskuelpprice bundlesave skuvatmsgsolutionsrangeproductpromoinfoinsidedeals campaignlockupimgsrc campaignlockupdisplayenvelopesuscoversincludevateach qty addeventpricectahref rangectahref rangesavingscallout16desk suppliesrangeimagesrc campaignctahrefclocksmediablackprivacy policygifttitlefurniture chairsadd to carttapestowelsrangesavingscallout3campaignctabutton see allspeechbubblebackgroundcentremarkersrangepromocallouttext rangeproducttitledataiskupricepercsymbolsku1pricef sku1pricesymbol pricemsgbundlesavedeals campaignlockupimgsrcmoredocumentreadyfunctiongifttitle productpromoinfo skuelppricepadcampaigntitlecolororganisationskuvatmsg ex vatcookiebucketsfunc5cleaners11tape desktype campaignbrandsnacksrangepromocallouttext rangeproducttitle rangeproductpromoinfocampaigninfocolorex vat sku1pricempromocallouttext producttitlepouchestapecampaignctabuttonpriceimagesrc pricesavingscallout1campaignlockupdisplay noneincustomlistdataitypeshreddersex vatvarfunctionbundlesave skuvatmsg exproduct your businesstonertissuesif dataitypedeskgrey campaigninfosucceeddeliverypricemsgfindexreviewsproductspeechbubbleborder whitelaminatingcampaigninfocolor red campaignctabuttonwetimeglossup7bucket cookiebucketsfunc nameplannersdrives accessoriesartif yourangesavingscallout1 rangesavingscallout2 rangesavingscallout2btowels tissuespackage 50rangectahref rangesavingscallout1 rangesavingscallout2sku1pricemcampaigntitlecolor grey campaigninfomoney2rangepromocallouttextpaper notebooksgloss deskyour business5 2heightcampaignlockupdisplay none campaignimgsrcnotebookssku1pricem sku1pricefrangecoupontext rangecouponcodeereaders13rangectabuttontextvat each qtystaples brandcampaignlockupimgsrc campaignlockupdisplay nonevat sku1pricemyourlabelscomputerfurnituretrackpackage 100 eachsku1pricem sku1pricef sku1pricesymbolofficeprivacymy accountwhite speechbubblebackground bgallwhitevat sku1pricem sku1pricefrangectahrefall deals campaignlockupimgsrcqty addaccounting formsneeds to succeedcustomer10returnboxespackagebundlesave skuvatmsghidepfchatredappliancesbucket cookiebucketsfunccampaign uniqueidpackage 100pricesavingscallout3 promocallouttextfurniture chairs cabinetsbucketspeechbubblebackground bgallwhiterangesavingscallout2b rangesavingscallout3producttitlebindersrangesavingscallout2 rangesavingscallout2b rangesavingscallout3campaignlockupdisplayskupriceperc skupricepercsymbol pricesavingscallout3productsif typeofpricectahref rangectahrefpricesavingscallout3 promocallouttext producttitleeverypromocallouttext producttitle gifttitlecandraftingmyonchatavailablepopuprangecoupontextspeechbubbleborderprinterscart 45rangectabuttontext rangelockupimgsrc rangelockupdisplaypackagingtypeofpricesavingscallout3securitybankingskupricepercsymbol pricesavingscallout3 promocallouttextrangectabuttontext rangelockupimgsrccalculatorsskuvatmsg exurlpricectabuttontextproductpromoinfo skuelpprice bundlesavepricectabuttontext pricectahrefwhite speechbubblebackgroundchairs cabinetscampaigninfocolor redrangelockupdisplayrangesavingscallout2 rangesavingscallout2bbag 100campaignctahrefskupriceperc skupricepercsymbolstaplessku1priceffalsehardwindowpflogpushchattea cateringadptindexrangecoupontext rangecouponcode rangecoupondisplayaddpriceimagesrcwater12staples174sku1pricesymbolpricectahrefundefinedproduct yourhererangesavingscallout1 rangesavingscallout2inkpricemsg pricectabuttontexteaselsboards easelsbgallwhite campaigntitlerangelockupimgsrcoffersaccountingorderformsnotpadsfilingall dealsbagchairred campaignctabuttonskuvatmsgbackrangeimagesrcex vat eachbagssuppliesrangecouponcodetruebusiness needsavailableyou buyschoolrangecouponcode rangecoupondisplayproductpromoinfovat eachpackage 36boardspenshelprangesavingscallout2b rangesavingscallout3 rangepromocallouttextwidthhavedatastarshtmlproductpromoinfo skuelpprice0cleaning facilitiesnone campaignimgsrcpostitbuyqtycalendarscoffeesku1pricesymbol pricemsg pricectabuttontextdigital cameraspaper notebooks cardsqcopypocketsskuelpprice bundlesavefiling binderswaysbottlevaluepricemsg pricectabuttontext pricectahrefbusinessdealshide wrapprimarynavimportantrangectahref rangesavingscallout1campaignimgsrcdigitalframesproducttitle gifttitle productpromoinfoyou needcampaignctabutton seesee allneedchairscampaigntitleworkrangeproducttitlerangesavingscallout3 rangepromocallouttext rangeproducttitlecampaignwhiteneedscookiebucketsfunc namepolicypricesskuelppricerangecoupondisplaybottle 15facilitiesshredders machinesourusewrapprimarynavpricesavingscallout1 skupriceperc skupricepercsymbolpricesavingscallout1 skupricepercuniqueidink tonernotesampspeechbubblebackground bgallwhite campaigntitlenonecampaignlockupimgsrcpricectabuttontext pricectahref rangectahrefaccessoriesreadyvat packagedealshide100 eacha4ream 500cartread morestorage9consolelogchatcatering48dealscabinetshelp youaccountifteaskupricepercsymbol pricesavingscallout3viewedpricechatloadedproducttitle gifttitlemachinesnamechatrequested3savesku1pricef sku1pricesymbolpriceimagesrc pricesavingscallout1 skupricepercdiariesbindingsafetysku1pricesymbol pricemsg

Longtail Keyword Density for Staples.co.uk

KeywordsOccurences
add to cart16
each qty add12
vat each qty9
ex vat each9
package 100 each4
see all deals4
ex vat package4
pricesavingscallout3 promocallouttext producttitle4
promocallouttext producttitle gifttitle4
producttitle gifttitle productpromoinfo4
speechbubblebackground bgallwhite campaigntitle3
campaigninfocolor red campaignctabutton3
campaigntitlecolor grey campaigninfo3
white speechbubblebackground bgallwhite3
red campaignctabutton see3
rangecoupontext rangecouponcode rangecoupondisplay3
rangectabuttontext rangelockupimgsrc rangelockupdisplay3
rangesavingscallout2b rangesavingscallout3 rangepromocallouttext3
speechbubbleborder white speechbubblebackground3
campaignlockupdisplay none campaignimgsrc3
product your business3
your business needs3
needs to succeed3
rangesavingscallout2 rangesavingscallout2b rangesavingscallout33
campaignlockupimgsrc campaignlockupdisplay none3
all deals campaignlockupimgsrc3
deals campaignlockupimgsrc campaignlockupdisplay3
campaignctabutton see all3
rangectahref rangesavingscallout1 rangesavingscallout23
skupriceperc skupricepercsymbol pricesavingscallout33
pricesavingscallout1 skupriceperc skupricepercsymbol3
skupricepercsymbol pricesavingscallout3 promocallouttext3
gifttitle productpromoinfo skuelpprice3
productpromoinfo skuelpprice bundlesave3
priceimagesrc pricesavingscallout1 skupriceperc3
type campaign uniqueid3
paper notebooks cards3
furniture chairs cabinets3
rangesavingscallout3 rangepromocallouttext rangeproducttitle3
rangepromocallouttext rangeproducttitle rangeproductpromoinfo3
skuelpprice bundlesave skuvatmsg3
bundlesave skuvatmsg ex3
pricemsg pricectabuttontext pricectahref3
pricectabuttontext pricectahref rangectahref3
pricectahref rangectahref rangesavingscallout13
bucket cookiebucketsfunc name3
sku1pricesymbol pricemsg pricectabuttontext3
sku1pricef sku1pricesymbol pricemsg3
skuvatmsg ex vat3
ex vat sku1pricem3
vat sku1pricem sku1pricef3
sku1pricem sku1pricef sku1pricesymbol3
rangesavingscallout1 rangesavingscallout2 rangesavingscallout2b3
ex vat21
see all20
qty add16
each qty12
vat each9
dealshide wrapprimarynav7
package 1006
100 each6
your business6
vat package4
shredders machines4
promocallouttext producttitle4
rangesavingscallout3 rangepromocallouttext4
all deals4
false var4
if dataitype4
boards easels4
gifttitle productpromoinfo4
producttitle gifttitle4
pricesavingscallout3 promocallouttext4
paper notebooks4
ink toner4
privacy policy4
read more4
you need4
grey campaigninfo3
campaigntitlecolor grey3
campaigninfocolor red3
red campaignctabutton3
if you3
campaignctabutton see3
package 503
bgallwhite campaigntitle3
rangelockupimgsrc rangelockupdisplay3
rangectabuttontext rangelockupimgsrc3
rangeimagesrc campaignctahref3
speechbubbleborder white3
speechbubblebackground bgallwhite3
white speechbubblebackground3
deals campaignlockupimgsrc3
campaignlockupimgsrc campaignlockupdisplay3
gloss desk3
ream 5003
business needs3
product your3
bag 1003
rangecouponcode rangecoupondisplay3
you buy3
package 363
none campaignimgsrc3
campaignlockupdisplay none3
cart 453
help you3
5 23
else if3
bottle 153
pricemsg pricectabuttontext3
accounting forms3
tea catering3
towels tissues3
cleaning facilities3
drives accessories3
digital cameras3
rangepromocallouttext rangeproducttitle3
if typeof3
staples brand3
desk accessories3
filing binders3
my account3
cookiebucketsfunc name3
bucket cookiebucketsfunc3
notebooks cards3
tape desk3
chairs cabinets3
furniture chairs3
desk supplies3
rangeproducttitle rangeproductpromoinfo3
type campaign3
pricectabuttontext pricectahref3
sku1pricesymbol pricemsg3
sku1pricef sku1pricesymbol3
sku1pricem sku1pricef3
pricectahref rangectahref3
rangectahref rangesavingscallout13
rangesavingscallout2b rangesavingscallout33
rangesavingscallout2 rangesavingscallout2b3
rangesavingscallout1 rangesavingscallout23
vat sku1pricem3
skuvatmsg ex3
pricesavingscallout1 skupriceperc3
priceimagesrc pricesavingscallout13
campaign uniqueid3
skupriceperc skupricepercsymbol3
skupricepercsymbol pricesavingscallout33
bundlesave skuvatmsg3
skuelpprice bundlesave3
productpromoinfo skuelpprice3
rangecoupontext rangecouponcode3
you31
var27
all23
vat23
ex21
see21
if21
each20
function17
staples17
add17
your17
cart16
qty16
paper16
015
more14
staples17414
accessories14
our14
package12
desk11
true11
supplies11
office11
available10
amp10
machines10
wrapprimarynav10
19
business9
storage9
type9
help9
false9
html9
furniture9
white8
filing8
a48
cash8
chair8
name8
27
packaging7
chairs7
37
dealshide7
shredders7
security7
we7
customer7
computer7
my7
up6
us6
order6
save6
ready6
deals6
chatavailable6
else6
binders6
46
boards6
notebooks6
calculators6
none6
ink6
get6
organisation5
best5
easels5
55
coffee5
black5
65
important5
75
adptindex5
products5
buy5
have5
boxes5
toner5
centre5
chatrequested5
value5
cards5
envelopes5
bags5
tapes5
policy5
pens5
tape5
labels5
printers4
digital4
campaignctabutton4
height4
event4
not4
inside4
school4
data4
datastars4
producttitle4
rangepromocallouttext4
rangesavingscallout34
rangesavingscallout14
rangeproducttitle4
rangeproductpromoinfo4
campaigntitle4
rangectabuttontext4
pricectabuttontext4
skuvatmsg4
promocallouttext4
pricesavingscallout34
pricesavingscallout14
ereaders4
gifttitle4
pricemsg4
productpromoinfo4
solutions4
cameras4
work4
accounting4
mailing4
dataitype4
appliances4
tea4
need4
facilities4
price4
documentreadyfunction4
can4
read4
delivery4
pouches4
laminating4
84
pad4
campaigninfo4
windowpflogpushchat4
94
consolelogchat4
account4
drives4
cabinets4
every4
hidepfchat4
campaign4
privacy4
diaries4
planners4
width4
water4
104
campaignlockupimgsrc3
campaignimgsrc3
datai3
campaignlockupdisplay3
red3
campaigninfocolor3
113
ways3
find3
gloss3
grey3
money3
viewed3
chatloaded3
apikey3
includevat3
popup3
succeed3
needs3
ream3
copy3
123
133
bottle3
bag3
product3
out3
reviews3
onchatavailable3
brand3
frames3
clocks3
pockets3
markers3
media3
post-it3
notes3
covers3
binding3
tissues3
catering3
teaching3
towels3
cleaners3
cleaning3
safety3
pads3
offers3
use3
technology3
cookieset3
snacks3
incustomlist3
url3
q3
bucket3
cookiebucketsfunc3
track3
item3
return3
contact3
so3
here3
prices3
drafting3
art3
rangesavingscallout23
rangesavingscallout2b3
rangecoupontext3
rangectahref3
pricectahref3
sku1pricef3
sku1pricesymbol3
rangecouponcode3
rangecoupondisplay3
speechbubbleborder3
speechbubblebackground3
bgallwhite3
campaignctahref3
rangeimagesrc3
rangelockupimgsrc3
rangelockupdisplay3
sku1pricem3
bundlesave3
time3
hard3
pen3
banking3
forms3
calendars3
whiteboards3
typeof3
undefined3
skupricepercsymbol3
skuelpprice3
skupriceperc3
priceimagesrc3
back3
uniqueid3
campaigntitlecolor3

What are the nameservers for staples.co.uk?

Staples.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.p28.dynect.net 208.78.70.28United States United States
ns2.p28.dynect.net 204.13.250.28United States United States
ns3.p28.dynect.net 208.78.71.28United States United States
ns4.p28.dynect.net 204.13.251.28United States United States
pdns131.ultradns.biz 156.154.66.131United States United States
pdns131.ultradns.com 156.154.64.131United States United States
pdns131.ultradns.net 156.154.65.131United States United States
pdns131.ultradns.org 156.154.67.131United States United States

Staples.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Staples.co.uk is a scam?