TV- & Film- Statister, Castings, Auditions, Skuespillere | Statist.dk

Safety: Low trust score
Year Founded: 2022
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Statist.dk - Nordens største castingsite! Hos os finder du jobs som statist, model, danser, skuespiller, entertainer og TV-publikum. Vær med i Borger, Forbrydelsen, Rita, Broen, reklamefilm og musikvideoer.



Domain summary

Last updated
2022-01-10
Domain label
statist
Domain extension
dk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Statist.dk registered?
A: Statist.dk was registered 1 week, 4 hours, 23 minutes, 20 seconds ago on Monday, January 10, 2022.
Q: When was the WHOIS for Statist.dk last updated?
A: The WHOIS entry was last updated 1 week, 4 hours, 23 minutes, 20 seconds ago on Monday, January 10, 2022.
Q: What are Statist.dk's nameservers?
A: DNS for Statist.dk is provided by the following nameservers:
  • ns2.dnshost.net
  • ns1.dnshost.net
Q: Who is the registrar for the Statist.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Statist.dk?
A: Statist.dk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Statist.dk each day?
A: Statist.dk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Statist.dk resolve to?
A: Statist.dk resolves to the IPv4 address .
Q: In what country are Statist.dk servers located in?
A: Statist.dk has servers located in the .
Q: What webserver software does Statist.dk use?
A: Statist.dk is powered by Apache/2.4.25 (Debian) webserver.
Q: Who hosts Statist.dk?
A: Statist.dk is hosted by Unknown in .
Q: How much is Statist.dk worth?
A: Statist.dk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Statist.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Statist.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Statist.dk

H1 Headings

1 :
  1. Nordens største castingsite!

H2 Headings

38 :
  1. Viser af 159 jobs
  2. Populære jobs
  3. Alle typer til ny tv-serie - løn!
  4. Medvirkende til kampagnefilm - løn!
  5. Medvirkende til filmoptagelser!
  6. Karakteristisk udseende 20-35 år til musikvideo!
  7. Søg medlemmer
  8. Vores medlemmers fotogalleri
  9. Aktuelle jobs
  10. Par i 30'erne til reklame!
  11. Skuespillerinde 40+ år - lønnet!
  12. Homoseksuelle mænd til ny tv-serie - løn!
  13. Alle typer til ny tv-serie - løn!
  14. Karakteristisk udseende 20-35 år til musikvideo!
  15. Medvirkende i 20'erne - løn!
  16. Medvirkende til kampagnefilm - løn!
  17. Medvirkende til filmoptagelser!
  18. Download vores app
  19. Få dine filmjob på din mobil, uanset hvor du er!
  20. Udvalgt job
  21. Alle typer til ny tv-serie - løn!
  22. Medvirkende til kampagnefilm - løn!
  23. Medvirkende til filmoptagelser!
  24. Karakteristisk udseende 20-35 år til musikvideo!
  25. Skuespillerinde 40+ år - lønnet!
  26. Medvirkende i 20'erne - løn!
  27. Homoseksuelle mænd til ny tv-serie - løn!
  28. Par i 30'erne til reklame!
  29. Alle typer til ny tv-serie - løn!
  30. Medvirkende til kampagnefilm - løn!
  31. Medvirkende til filmoptagelser!
  32. Karakteristisk udseende 20-35 år til musikvideo!
  33. Skuespillerinde 40+ år - lønnet!
  34. Medvirkende i 20'erne - løn!
  35. Homoseksuelle mænd til ny tv-serie - løn!
  36. Par i 30'erne til reklame!
  37. Bliv medlem
  38. Indryk annonce

H3 Headings

1 :
  1. ANTAL HITS: 16869

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

34 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-425672-2

Links - Internal

72:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Statist.dk

inden du sgermnd tilsger familiestatister medvirkende tillocation kbenhavnsomrdet6570ln statister sgesstatister sges tildatatype htmlborder 0pxtvserie optagelse 32lejligheder6570 rstor artistkarakteristisk udseende 2035ls merekbenhavnsomrdet dopslaget30erne til optagelseheightln vitil en nymandhomoseksuellekort spot tilkbenhavnsomrdet d 180121corporatevi filmeretkvinder spillealderaf kortmnd mellem20erne sges tildetfamilie morbodyoptagelsekvinde 40 sgesopenremoveclassopen20erne sges32 tidspunktnyt danskalle typer tilln kvindemandpardatatypemnd til nymere medvirkendevoresfilm vi sgertyper til nyuge 2hele opslagetmedlemmerstor artist somtil en musikvideolnnet sgerjan statister medvirkende40pxartist som skaltopdu sger familiep40 roptagelse af40 sgesstatister sgersdivmenurow div3335 r farsger skuespillerindelidtsger homoseksuelle mnd5pxstatistln efter aftaleeller 3 prcisbetatogglecastflgende castmor 3335thonorar lnalle typersom skal optagesifwindowwidth700positionmorheledivmenurow divdropdownmenutoggledropdownmenuopentvserie ln visgesdansk tvserie50pxfilm vilastsearchmed lejligheder0pxviln dags optagelserudlejningsfirma medder sges mndmusikvideonyt udlejningsfirmavi sger lidt12ln statisterls mere honorarjanhonorarvistartupkoncept indenkvindehonorar ln efterkampagnefilm ln statistertil corporate brandingvi sgerudseendedansk20erne lnreklametv kanalhonorar 500 krsges flgende castspot tilopslaget inden dumnd mellem 18typerdu sgeroptagesurlkanalmedvirkende i 20ernetil ndage tilbage4leftmaincontainermedvirkende tildagemellem 18 ogsger statisteraftalekarakteristisk udseendehomoseksuelle mnd tilskuespillerwebappdansk startupkoncept indenstatister tiloptagelse 32cast ls helemedvirkende til filmoptagelserfilmoptagelse sges flgendedeniedjan statisterlnnet sger skuespillerindekampagnefilmmeddating videoenspot til nyttrueskuespillerinde kvindedet centraleudlejningsfirmapareller 3kort spotsges flgendenyt udlejningsfirma medtil musikvideocentraledivmenuarea openremoveclassopenbranding filmlnnet lnnet20erneforskelligeeventstoppropagation2035artistlocationstatister sgeskanal dermaxwidthdagsom skalspillealderbrandingdivfalsemusikvideo vitil filmoptagelser til30erneny dansk tvseriefreetextfilmoptagelseoptagelserbackgroundcolorn dags3335ls18 ogtvserie ln statistersger skuespillerinde kvindemndmor 3335 ret nytmedvirkende til kampagnefilmhtmldating videoen vilfamiliesges mndprcis40 sges tilmeremk i 30ernemere medvirkende tiltype46px1tvserie lnfra32 tidspunkt ikkeartist sommobilskaltil reklame sgerdusettimeoutfunctionpar i 30ernesgers til corporate18 og 65newduration30erne tilmusikvideo vi sgertil optagelse afformajaxkr 310skuespillerinde 40 rtvserietil videolejligheder i detafny tvserie ln3335 rlandsdkkende tvsgeroptages i kbenhavnsomrdetabsolute2 ellervar10pxsges mnd kvinder7flerehonorar 500datingifwindowwidth700 divmenuareasger homoseksuellestatisterskuespillerborderls mere medvirkendeuge 2 ellerlnnet lnnet sger11searchvalmnd kvinder spillealderr tilindennyt dansk startupkonceptlineheightsortorderpagenumberder sgeskbenhavnffftil corporateborderradiuscenterdagsny stortil reklame3 prcisfstor tvseriemedlem3reklame sgerog 65mkmere honorarfilmoptagelse sgesudlejningsfirma med lejlighedersges tilderudover40 r lnnettil nysges til nfilmny dansklidt forskellige statisterudseende 2035 rjobsikkevideoenmusikvideo tiloptagelse af kortpar mksearchadvertlisttruetil en stor6honorar 750mnd kvinder2jobs medtil filmoptagelseforskellige statister tilny stor tvseriecast lskvinde 40eftertil filmoptagelse sgesogsgersskuespillerinde 40farkbenhavnsomrdetln efterstatister til corporateimportantny9til nytsges til nyjan statisterskuespillerkvindemandpar i 20ernedivmenurowkvindemandparhonorar 750 krstatisterbranding film visger lidtfunctionkbenhavn i uge30pxs3 jansger statister tiltil optagelse8skuespillerinde kvinde 40kr 3 janvi sger statistereraf kort spotsger lidt forskelligeog 65 relse65 rr lnnettilbagetv kanal derdags optagelserstorudseende 2035sgers tildivdropdownmenutoggledropdownmenuopenls hele2035 ralletil n dagskvindertil ny tvseriedstatister sgers tiltvserie optagelsekampagnefilm lntidspunkt ikkelnnetr mandlidt forskelligehele opslaget inden30erne til reklameet nyt danskr lnnet lnnetflgende cast lshomoseksuelle mndkanhomoseksuelle mnd mellem2035 r tilifwindowwidth700 divmenuarea openremoveclassopensger to par0sger familie morsges til videotil musikvideo viwidthoptagelser i kbenhavntil nyt udlejningsfirmatvserie for landsdkkendeposition absolutekrpaddingcorporate brandingtil ny stordansk tvserie optagelsefilmoptagelser til filmoptagelse700pxlnr farr500 krcorporate branding filmln statister sgersmellem 18statister medvirkendetil filmoptagelserny tvserieln vi sgerjanuarsearchactionbuttonattrsrcfilmer750 krajax type20erne ln kvindemandparforskellige statisterinden du2 eller 3tvfontsizestartupkonceptdisplayr til musikvideouge26pxoptagelse 32 tidspunktkanal der sges20pxdivmenuareaopslaget indensomfilmoptagelser tildansk startupkoncepthidesearchclearbuttonkortskuespillerindedermedvirkendefamilie mor 3335til kampagnefilm lnnnytflgendelandsdkkendevideotildialogls hele opslagetinden for dating5video for etlandsdkkende tv kanalefter aftaled 18012165 r tilvi sger homoseksuelleellerskal optagesrightvideoen viltidspunkttil kampagnefilm3 jan statisterskuespillerspottyper tilkarakteristiskfilmoptagelsermellem

Longtail Keyword Density for Statist.dk

KeywordsOccurences
til ny tv-serie7
ny tv-serie ln7
til corporate branding6
corporate branding film6
ln efter aftale5
honorar ln efter5
ls mere medvirkende5
mor 33-35 r4
familie mor 33-354
sger familie mor4
du sger familie4
opslaget inden du4
hele opslaget inden4
ls hele opslaget4
cast ls hele4
flgende cast ls4
sges flgende cast4
filmoptagelse sges flgende4
til filmoptagelse sges4
33-35 r far4
artist som skal4
karakteristisk udseende 20-354
til en musikvideo4
kbenhavnsomrdet d 1801214
optages i kbenhavnsomrdet4
som skal optages4
alle typer til4
stor artist som4
til en stor4
sger statister til4
til filmoptagelser til4
vi sger statister4
musikvideo vi sger4
til musikvideo vi4
r til musikvideo4
20-35 r til4
udseende 20-35 r4
filmoptagelser til filmoptagelse4
inden du sger4
medvirkende til filmoptagelser4
mnd kvinder spillealder4
typer til ny4
kr 3 jan4
ln statister sges4
statister sges til4
sges til ny4
til ny stor4
ny stor tv-serie4
tv-serie for landsdkkende4
landsdkkende tv kanal4
tv kanal der4
kanal der sges4
der sges mnd4
sges mnd kvinder4
tv-serie ln statister4
medvirkende til kampagnefilm4
branding film vi4
statister til corporate4
lidt forskellige statister4
sger lidt forskellige4
vi sger lidt4
film vi sger4
forskellige statister til4
sgers til corporate4
statister sgers til4
ln statister sgers4
kampagnefilm ln statister4
til kampagnefilm ln4
homoseksuelle mnd mellem3
65 r til3
og 65 r3
18 og 653
mellem 18 og3
mnd mellem 183
ln vi sger3
sger homoseksuelle mnd3
vi sger homoseksuelle3
homoseksuelle mnd til3
tv-serie ln vi3
mnd til ny3
eller 3 prcis3
ny dansk tv-serie3
til en ny3
kvindemandpar i 20erne3
dansk tv-serie optagelse3
video for et3
mere medvirkende til3
uge 2 eller3
dating videoen vil3
dansk startup-koncept inden3
nyt dansk startup-koncept3
et nyt dansk3
sges til video3
tv-serie optagelse 323
20erne sges til3
inden for dating3
20erne ln kvindemandpar3
medvirkende i 20erne3
32 tidspunkt ikke3
optagelse 32 tidspunkt3
2 eller 33
ifwindowwidth700 divmenu-area openremoveclassopen3
kbenhavn i uge3
til reklame sger3
af kort spot3
optagelse af kort3
til optagelse af3
30erne til optagelse3
mk i 30erne3
sger to par3
30erne til reklame3
spot til nyt3
par i 30erne3
3 jan statisterskuespiller3
honorar 750 kr3
honorar 500 kr3
statister medvirkende til3
jan statister medvirkende3
kort spot til3
til nyt udlejningsfirma3
optagelser i kbenhavn3
sger skuespillerinde kvinde3
n dags optagelser3
til n dags3
sges til n3
40 sges til3
kvinde 40 sges3
skuespillerinde kvinde 403
lnnet sger skuespillerinde3
nyt udlejningsfirma med3
lnnet lnnet sger3
r lnnet lnnet3
40 r lnnet3
skuespillerinde 40 r3
lejligheder i det3
udlejningsfirma med lejligheder3
ls mere honorar3
ls mere17
vi sger11
til ny11
sges til10
ln statister8
divmenu-area openremoveclassopen8
statister til8
medvirkende til8
til corporate8
ny tv-serie7
r til7
tv-serie ln7
33-35 r6
jan statister6
karakteristisk udseende6
branding film6
alle typer6
30erne til6
homoseksuelle mnd6
corporate branding6
3 jan5
efter aftale5
ln efter5
honorar ln5
mere medvirkende5
hele opslaget4
sger familie4
du sger4
inden du4
opslaget inden4
ls hele4
cast ls4
flgende cast4
familie mor4
r mand4
mor 33-354
musikvideo til4
d 1801214
kbenhavnsomrdet d4
skal optages4
som skal4
artist som4
stor artist4
sger statister4
r far4
musikvideo vi4
til musikvideo4
20-35 r4
udseende 20-354
til filmoptagelse4
65-70 r4
sges flgende4
filmoptagelse sges4
filmoptagelser til4
til kampagnefilm4
divmenu-row divdropdownmenu-toggledropdownmenu-open4
typer til4
statister sges4
ny stor4
landsdkkende tv4
tv kanal4
kanal der4
der sges4
sges mnd4
mnd kvinder4
kvinder spillealder4
stor tv-serie4
kampagnefilm ln4
film vi4
kr 34
til filmoptagelser4
vi filmer4
lidt forskellige4
sger lidt4
forskellige statister4
sgers til4
statister sgers4
eller 33
2 eller3
65 r3
uge 23
3 prcis3
dags optagelser3
mnd til3
n dags3
ln vi3
sger homoseksuelle3
mnd mellem3
mellem 183
18 og3
og 653
videoen vil3
ny dansk3
et nyt3
dansk startup-koncept3
20erne sges3
ln kvindemandpar3
20erne ln3
tidspunkt ikke3
40 sges3
til video3
dansk tv-serie3
startup-koncept inden3
dating videoen3
32 tidspunkt3
nyt dansk3
optagelse 323
tv-serie optagelse3
til n3
border 0px3
kvinde 403
honorar 5003
jan statisterskuespiller3
position absolute3
dage tilbage3
750 kr3
honorar 7503
500 kr3
statister medvirkende3
reklame sger3
location kbenhavnsomrdet3
jobs med3
datatype html3
ajax type3
ifwindowwidth700 divmenu-area3
divmenu-row div3
til reklame3
par mk3
skuespillerinde kvinde3
det centrale3
sger skuespillerinde3
lnnet sger3
lnnet lnnet3
r lnnet3
40 r3
skuespillerinde 403
med lejligheder3
til optagelse3
udlejningsfirma med3
nyt udlejningsfirma3
til nyt3
spot til3
kort spot3
af kort3
optagelse af3
mere honorar3
til68
r29
statister24
mere22
function22
sger21
ls21
sges20
ln19
honorar18
divmenu-row16
vi15
tv-serie14
ny14
013
kr13
mnd12
af11
else11
medvirkende11
med11
p11
var11
jobs11
du10
jan10
eller9
kvinde9
width9
height9
dansk8
openremoveclassopen8
divmenu-area8
18
28
stor8
alle8
optagelse8
vil8
musikvideo8
d8
par8
corporate8
som8
kbenhavn7
kbenhavnsomrdet7
0px7
position7
inden7
lnnet7
statist7
display7
og7
homoseksuelle6
skal6
karakteristisk6
20erne6
nyt6
forskellige6
30erne6
udseende6
branding6
film6
dialog6
skuespillerinde6
33-356
kvinder6
efter6
mand6
background-color6
typer6
det5
40px5
tv5
dage5
der5
aftale5
et5
max-width5
10px5
35
mor5
padding5
optages4
44
54
filmer4
artist4
20-354
65-704
false4
webapp4
filmoptagelser4
filmoptagelse4
flgende4
search-action-buttonattrsrc4
lastsearch4
cast4
hele4
ikke4
opslaget4
familie4
video4
t4
far4
f4
denied4
lidt4
location4
center4
64
top4
sgers4
50px4
div4
46px4
divdropdownmenu-toggledropdownmenu-open4
right4
beta-toggle4
700px4
74
ifwindowwidth7004
spillealder4
fff4
kanal4
landsdkkende4
kan4
fra4
main-container4
searchadvertlisttrue4
kampagnefilm4
settimeoutfunction4
font-size3
mellem3
prcis3
83
93
103
tidspunkt3
true3
5px3
dag3
duration3
30px3
er3
border3
absolute3
kvindemandpar3
startup-koncept3
dating3
optagelser3
videoen3
20px3
new3
pagenumber3
sortorder3
hidesearchclearbutton3
freetext3
uge3
spot3
dags3
skuespiller3
ajax3
derudover3
type3
url3
datatype3
html3
vores3
eventstoppropagation3
form3
searchval3
s3
flere3
januar3
body3
113
tilbage3
n3
mk3
left3
centrale3
lejligheder3
udlejningsfirma3
mobil3
kort3
reklame3
medlemmer3
26px3
statisterskuespiller3
border-radius3
line-height3
123
medlem3
important3

Who hosts Statist.dk?

Statist.dk Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache/2.4.25 (Debian)

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%

HTTP Header Analysis for Statist.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 200
Date: Mon, 10 Jan 2022 16:56:22 GMT
Server: Apache/2.4.25 (Debian)
Content-Type: text/html;charset=ISO-8859-1
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 17933

Statist.dk Domain Nameserver Information

HostIP AddressCountry
ns2.dnshost.net 185.167.176.1
ns1.dnshost.net 91.237.67.1


Need to find out who hosts Statist.dk?


Domain Registration (WhoIs) information for Statist.dk

Websites with Similar Names

Statistics.com
Statistics.com: Data Science, Analytics & Statistics Courses
Statista.com
• Statista - The Statistics Portal for Market Data, Market Research and Market Studies
Staticice.com.au
staticICE - Compare Prices - Australia - Shopping and price comparison for computer hardware, digital SLR cameras and consumer electronics
Statichtmlapp.com
Thunderpenny | Static HTML
Station-drivers.com
Station-Drivers - NEWS
Statigr.am
Iconosquare - Instagram & Facebook Analytics and Management Platform
Stationeryhq.com
StationeryHQ.com
Statisticssolutions.com
Statistics Solutions: Dissertation and Research Consulting For Statistical Analysis
Statistics.gr
Κεντρική Σελίδα ΕΛΣΤΑΤ - ELSTAT
Statistikian.com
Statistikian - Uji Statistik

Recently Updated Websites

Covetboston.com (5 seconds ago.)Paypool.fun (6 seconds ago.)Bestbizpractices.org (7 seconds ago.)Virtualjpy.com (10 seconds ago.)A-great-intl-create-website.fyi (12 seconds ago.)Marquezma.com (13 seconds ago.)Devsens.com (17 seconds ago.)Denveronlineauction.com (17 seconds ago.)Rightnowinventory.com (19 seconds ago.)Southsidesoftball.info (21 seconds ago.)Trygothamstackmaster.com (25 seconds ago.)Pharmapcdhub.com (26 seconds ago.)Seaaimports.com (27 seconds ago.)Azcompleterepair.com (28 seconds ago.)Directleaseprive.be (31 seconds ago.)Capitalamc.us (32 seconds ago.)Win-heart.com (33 seconds ago.)Titanzoom.com (37 seconds ago.)E-conomic.se (39 seconds ago.)Autoflexsharespro.com (40 seconds ago.)Sineusyn.com (40 seconds ago.)Lifeplans.net (41 seconds ago.)Szzhtest17.com (41 seconds ago.)Rvfragrance.com (43 seconds ago.)Lotsavatars.com (48 seconds ago.)Two-n-one.com (49 seconds ago.)Viruxal.info (50 seconds ago.)Merakisolarguy.com (50 seconds ago.)Cashorganizer.com (57 seconds ago.)Cloudcoding.info (58 seconds ago.)

Recently Searched Keywords

meta description length checker (2 seconds ago.)vat calculation (3 seconds ago.)etm ekonom yaam (4 seconds ago.)cheap flights to india (5 seconds ago.)अपराध (7 seconds ago.)fort lauderdale fl restorative dentist (8 seconds ago.)importantnext ahoverpadding4px importantotherproductcelnum1containerwidth100 (9 seconds ago.)注册办公室 (11 seconds ago.)je sortirai (11 seconds ago.)je sortirai (12 seconds ago.)​中华人民共和国第一届职业技能大赛河南省选拔赛在我校举行 (12 seconds ago.)2020-07-24 bob (13 seconds ago.)magic pet gate safe guard — sale price $17.12  (14 seconds ago.)brickleberry (20 seconds ago.)mgstamiausi (24 seconds ago.)vat210total (25 seconds ago.)гель для кожи вокруг глаз (28 seconds ago.)理士蓄电池 (30 seconds ago.)konsistens og (33 seconds ago.)манчестер юнайтед выбрал компанию кармод детали проекта (35 seconds ago.)traininganybody can achieve (37 seconds ago.)too short (42 seconds ago.)patient portal tricare (44 seconds ago.)consumption tax applied (45 seconds ago.)qyl22 (49 seconds ago.)zapojení do spolupráce s we|do: e-shop (50 seconds ago.)sectionquicksearchresultsremoveclassactivefadeout (51 seconds ago.)shell gropbrov (55 seconds ago.)kuchnia włoska (56 seconds ago.)weekly special (56 seconds ago.)