Streetpulse.net Favicon Streetpulse.net

Streetpulse.net Website Thumbnail
Checking...
Street Pulse Records

Safety: Low trust score
Year Founded: 2017
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-28
Category: This site has not been categorized yet

Berlin based record label


Domain summary

Domain label
streetpulse
Domain extension
net
Domain registered:
2017-11-05
Domain updated:
2020-10-06
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is streetpulse.net ranked relative to other sites:

Percentage of visits to streetpulse.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Streetpulse.net registered?
A: Streetpulse.net was registered 3 years, 2 weeks, 6 days, 8 hours, 13 minutes, 34 seconds ago on Sunday, November 5, 2017.
Q: When was the WHOIS for Streetpulse.net last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 5 days, 8 hours, 13 minutes, 34 seconds ago on Tuesday, October 6, 2020.
Q: What are Streetpulse.net's nameservers?
A: DNS for Streetpulse.net is provided by the following nameservers:
  • ns4.wixdns.net
  • ns5.wixdns.net
Q: Who is the registrar for the Streetpulse.net domain?
A: The domain has been registered at ASCIO TECHNOLOGIES, INC. DANMARK - FILIAL AF ASCIO TECHNOLOGIES, INC. USA.
Q: What is the traffic rank for Streetpulse.net?
A: Streetpulse.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Streetpulse.net each day?
A: Streetpulse.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Streetpulse.net resolve to?
A: Streetpulse.net resolves to the IPv4 address 23.236.62.147.
Q: In what country are Streetpulse.net servers located in?
A: Streetpulse.net has servers located in the United States.
Q: What webserver software does Streetpulse.net use?
A: Streetpulse.net is powered by webserver.
Q: Who hosts Streetpulse.net?
A: Streetpulse.net is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Streetpulse.net worth?
A: Streetpulse.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Streetpulse.net?

Streetpulse.net Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Streetpulse.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 28 Oct 2020 20:12:54 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.streetpulse.net/
x-wix-request-id: 1603915974.11656345411595678988
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVi9UwUuevlgidOw7LozzCz1,2d58ifebGbosy5xc FRaljyqoH595/c5ir0M9b5pjawdw/8pOAvdXSV7brHXeISoLE5Dhtl2K41JEH3y5assxw==,2UNV7KOq4oGjA5 PKsX47EAqIWNBw7tMwm1Esy VM5Y=,m0j2EEknGIVUW/liY8BLLuif/7v3AvaTfR9jgZjb6FU=,dvEkI3CoQ26/kOBf/eu3DAqu8h6MfrxxgAfPT7/12zJGp/J3MBzgzU8QHrQuh4zQ,znxyTGNb715cyF9N4jtLDE2WgvYlaCSAg6 1HTHT0XecMTAeWt6RKuOWL0AAvc G
Cache-Control: no-cache
Expires: -1

Streetpulse.net Domain Nameserver Information

HostIP AddressCountry
ns4.wixdns.net 216.239.36.101
ns5.wixdns.net 216.239.38.101


Need to find out who hosts Streetpulse.net?


Domain Registration (WhoIs) information for Streetpulse.net

 Domain Name: STREETPULSE.NET
Registry Domain ID: 2183773431_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.ascio.com
Registrar URL: http://www.ascio.com
Updated Date: 2019-10-28T22:55:15Z
Creation Date: 2017-11-05T22:41:33Z
Registry Expiry Date: 2020-11-05T22:41:33Z
Registrar: Ascio Technologies, Inc. Danmark - Filial af Ascio technologies, Inc. USA
Registrar IANA ID: 106
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4165350123
Domain Status: ok https://icann.org/epp#ok
Name Server: NS4.WIXDNS.NET
Name Server: NS5.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-31T11:32:34Z

Streetpulse.net Free SEO Report

Website Inpage Analysis for Streetpulse.net

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

3 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. http://www.facebook.com/streetpulserecords
    http://www.facebook.com/streetpulserecords
  2. https://instagram.com/street__pulse
    https://instagram.com/street__pulse

Links - Outbound (nofollow)

0:

Keyword Cloud for Streetpulse.net

recordpulsehidetitletrueicondescriptionseoberlin based recordrecordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock 3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreetpulsehidetitletrueicondescriptionseoberlinpulse recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestockpositionfixed importantleftautopositionfixed importantleftauto importantzindex50arial blackarialw01blackarialw02blackarialw10varfff strokewidth 0labeltypetitlechildrenstreetlabeltypetitlechildrenstreet pulse recordstypemetapropsnamedescriptioncontentberlinlabelmetakeywordsseopagetitleseostreet pulsenormal0 0980pxbased recordtxtnew ulfill fffimportantzindex50recordstypemetapropsnamedescriptioncontentberlin based recordcalc100blackarialw01blackarialw02blackarialw10 blacksansserifrecordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock 3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet pulsemarginleft calc100ulpulse recordstypemetapropspropertyogdescriptioncontentrecord labeltypetitlechildrenstreetblacksansserif color2f2f30pulsehidetitletrueicondescriptionseoberlin basedolfff strokewidthultxtnew olffffffstreetnormal normalffflabelmetakeywordsseopagetitleseostreet pulse recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestockmarginleft calc100 980pxrecordstypemetapropsnamedescriptioncontentberlin based2blackarialw01blackarialw02blackarialw10 blacksansserif color2f2f30ultxtnewrecord labelmetakeywordsseopagetitleseostreet pulsefff stroke fffoldirrtlpulse recordstypemetapropsnamedescriptioncontentberlin basedblackarialw01blackarialw02blackarialw10margin0lineheightnormalletterspacingnormal txtnewpositionabsolutetop0right0bottom0left005arial blackarialw01blackarialw02blackarialw10 blacksansserifbackgroundcolorifbackgroundcolor ffffff980px 05calc100 980pxarialimportantleftauto importantzindex503pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreetfontcolorlb1itemscontainermargin0lineheightnormalletterspacingnormalrecordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestocktxtnew3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet pulsestreet pulsecolor2f2f30strokewidthtopautobottom0calc100 980px 05blacksansserifrecordstypemetapropspropertyogdescriptioncontentrecord labeltypetitlechildrenstreet pulselindapositionfixedfont normal1font normal normalstrokestroke fff strokewidthpulse recordstypemetapropsnamedescriptioncontentberlinlabeltypetitlechildrenstreet pulse0pulse recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock 3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreetpulse recordstypemetapropspropertyogdescriptioncontentrecordimportantimportantleftautopositionstaticboxshadow000recordstypemetapropsnamedescriptioncontentberlinol ulstrokewidth 0basedmarginleftpositionstaticboxshadow000 0based record labelmetakeywordsseopagetitleseostreetfill fff strokepulserecord labelmetakeywordsseopagetitleseostreetstreet pulse recordstypemetapropsnamedescriptioncontentberlinlabelmetakeywordsseopagetitleseostreetraumfff strokeb0b0b0recordstypemetapropspropertyogdescriptioncontentrecord labeltypetitlechildrenstreetnormal normal normalnbspfillstroke fffrecordstypemetapropspropertyogdescriptioncontentrecordcolor ffffffpositionstaticboxshadow000 0 03pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet pulse recordstypemetapropspropertyogdescriptioncontentrecord

Longtail Keyword Density for Streetpulse.net

KeywordsOccurences
margin-left calc100 980px16
calc100 980px 0516
font normal normal11
normal normal normal11
recordstypemetapropsnamedescriptioncontentberlin based record9
pulse recordstypemetapropsnamedescriptioncontentberlin based9
arial blackarial-w01-blackarial-w02-blackarial-w10 blacksans-serif6
blackarial-w01-blackarial-w02-blackarial-w10 blacksans-serif color2f2f306
fff stroke-width 05
street pulse recordstypemetapropsnamedescriptioncontentberlin5
stroke fff stroke-width5
fff stroke fff5
fill fff stroke5
based record labelmetakeywordsseopagetitleseostreet3
record labelmetakeywordsseopagetitleseostreet pulse3
labelmetakeywordsseopagetitleseostreet pulse recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock3
pulse recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock 3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet3
recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock 3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet pulse3
3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet pulse recordstypemetapropspropertyogdescriptioncontentrecord3
pulse recordstypemetapropspropertyogdescriptioncontentrecord labeltypetitlechildrenstreet3
recordstypemetapropspropertyogdescriptioncontentrecord labeltypetitlechildrenstreet pulse3
labeltypetitlechildrenstreet pulse recordstypemetapropsnamedescriptioncontentberlin3
positionstaticbox-shadow000 0 03
positionfixed importantleftauto importantz-index503
pulsehidetitletrueicondescriptionseoberlin based record3
normal normal22
based record17
margin-left calc10016
980px 0516
calc100 980px16
font normal11
street pulse10
recordstypemetapropsnamedescriptioncontentberlin based9
pulse recordstypemetapropsnamedescriptioncontentberlin9
margin0line-heightnormalletter-spacingnormal txtnew7
blacksans-serif color2f2f306
arial blackarial-w01-blackarial-w02-blackarial-w106
blackarial-w01-blackarial-w02-blackarial-w10 blacksans-serif6
fill fff5
stroke-width 05
stroke fff5
fff stroke5
fff stroke-width5
color ffffff4
background-color ffffff4
txtnew ul4
pulse recordstypemetapropspropertyogdescriptioncontentrecord4
positionstaticbox-shadow000 03
0 03
labeltypetitlechildrenstreet pulse3
recordstypemetapropspropertyogdescriptioncontentrecord labeltypetitlechildrenstreet3
3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet pulse3
pulse recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock3
recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock 3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet3
labelmetakeywordsseopagetitleseostreet pulse3
record labelmetakeywordsseopagetitleseostreet3
pulsehidetitletrueicondescriptionseoberlin based3
ultxtnew ol3
importantleftauto importantz-index503
ol ul3
positionfixed importantleftauto3
background-color36
color36
normal33
pulse26
txtnew18
record17
based17
margin-left16
calc10016
980px16
0516
014
positionabsolutetop0right0bottom0left011
font11
street10
ul10
fff10
color2f2f309
recordstypemetapropsnamedescriptioncontentberlin9
ffffff8
margin0line-heightnormalletter-spacingnormal7
ol7
var7
arial6
blackarial-w01-blackarial-w02-blackarial-w106
blacksans-serif6
important5
fill5
raum5
stroke5
stroke-width5
ultxtnew5
if5
lb1itemscontainer4
recordstypemetapropspropertyogdescriptioncontentrecord4
14
linda4
24
b0b0b04
positionstaticbox-shadow0003
topautobottom03
pulsehidetitletrueicondescriptionseoberlin3
positionfixed3
labelmetakeywordsseopagetitleseostreet3
oldirrtl3
recordspageuriseoartistshidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpj9zii8debgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock20120liteneditedjpguri0c1938df07c5478edb4594898f380d9f18fe4fmv2jpgdescriptionprivatewidth2084height1389altartistidnamecolorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleadobestock3
3pnguri0c193882fd3cfbc5a24fcf94a80aedb256b639mv2pngdescriptionprivatewidth1500height1000altartistidnameopacity1colorcolor11aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kfwl2af7metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgwidth709height709altadvancedseodatatagstypemetapropspropertyogimagecontent0c1938e296d59cc1964e129f847df61e02cbc6mv2jpgmetawidth709height709typemetapropspropertyogtitlecontentstreet3
importantz-index503
labeltypetitlechildrenstreet3
nbsp3
importantleftauto3

Streetpulse.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Stree-samyabooks.com
Stree - Samya Books
Stree.link
Music Diary | 部屋充ライフの音楽日記です
Streeamlord.com
streeamlord.com
Streeateasy.com
streeateasy.com -&nbspThis website is for sale! -&nbspstreeateasy Resources and Information.
Streeatfoodtruckfestival.com
STREEAT® – Food Truck Festival
Streeban.info
Stress, the Bane of Modern Life
Streebigroppwedding.com
Lauren Streebig & Alan Ropp — Minted

Recently Updated Websites

Aypam.com.tr 4 minutes 42 seconds ago.Kentboringer.com 7 minutes 16 seconds ago.Soyyigit.com 7 minutes 18 seconds ago.Ofisshop.com.tr 8 minutes 6 seconds ago.Enboyetiket.com 8 minutes 20 seconds ago.Primekitchen.co.in 8 minutes 47 seconds ago.Digitalakhbaar.com 10 minutes 46 seconds ago.Mexsty.com 10 minutes 56 seconds ago.Verseon.com 11 minutes 6 seconds ago.Valuecareathome.info 12 minutes 3 seconds ago.Outlookfarm.com 12 minutes 15 seconds ago.Askwitty.com 12 minutes 20 seconds ago.Acerojoyeria.com 12 minutes 23 seconds ago.Colinedwardsphoto.com 12 minutes 24 seconds ago.Capeco.de 12 minutes 26 seconds ago.Smartibpro.com 12 minutes 28 seconds ago.American-automobiles.com 12 minutes 33 seconds ago.Czszshg.com 12 minutes 35 seconds ago.Leaderpartner.ru 12 minutes 37 seconds ago.Southernlifecompany.com 12 minutes 37 seconds ago.Beefacts.net 12 minutes 40 seconds ago.Natchezbike.org 12 minutes 45 seconds ago.Atpesercizio.it 12 minutes 46 seconds ago.La-boutique-du-gazon-synthetique.com 12 minutes 49 seconds ago.Preferredwindowanddoor.com 12 minutes 50 seconds ago.Wishflex.com 12 minutes 55 seconds ago.Ukrline.com.ua 13 minutes 1 second ago.Webapplication.online 13 minutes 4 seconds ago.Sungiftsgroup.com 13 minutes 4 seconds ago.Omidmp.com 13 minutes 5 seconds ago.