Review - Stripe553
5 out of 5 based on 3 user ratings.  |  Stripe
Stripe is a suite of APIs that powers commerce for businesses of all sizes.

Registration Date:
Domain Registrar:
Service Provider:, Inc.  United States
High trust score
Late Updated:
5 months 6 days ago Website Information was registered 2 decades 2 years ago. It is the world's 3,189rd most popular site among over 300 million websites. It is a domain with an .com extension and is hosted by, Inc..
It has an estimated worth of $ 8.95 and has an average daily income of approximately $ 0.15. is SAFE to browse as we did not find any active threats.

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:3,189
Majestic Rank Majestic Rank:3,293
PageSpeed Google PageSpeed:0%
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Social Engagement for

Facebook Shared:9,985
Facebook Like Count:0
Facebook Comment Count:0
Twitter Tweets:190
LinkedIn Shares:1,226
Google Plus Shares:4,619 Traffic Report

Daily Unique Visitors:Not Applicable
Daily Pageviews:Not Applicable Estimated Valuation

Income Per Day:$ 0.15
Estimated Worth:$ 8.95

Search Engine Indexes for

Google Indexed Pages:4,980
Yahoo Indexed Pages:View Yahoo pages
Bing Indexed Pages:View Bing pages
History:View WayBackMachine history

Search Engine Backlinks for

Google Backlinks:9,270,000
Bing Backlinks:0
Alexa BackLinks:0

Safety Information for

Google Safe Browsing:No Risk Issues
Siteadvisor Rating:No Risk Issues
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Domain Information for

Domain Registrar: SAFENAMES LTD
Registration Date:1995-09-12  2 decades 2 years 2 months ago
Last Modified:2015-09-12  2 years 2 months 4 days ago
Expiration Date:2025-09-11  7 years 9 months 2 weeks from now

Similarly Ranked Websites to

3,187 CNN TÜRK Ana Sayfa - CNN TÜRK

CNN TÜRK Ana Sayfa

3,188 Esquire - Latest News, Politics, Men's Fashion, Grooming Advice,...

Esquire is your destination for the latest news headlines, political developments, celebrity interviews, mens fashion advice, and food & drink recipes.

3,189 Stripe

Stripe is a suite of APIs that powers commerce for businesses of all sizes.

3,190 403 Forbidden

3,192 the HD porn video search engine -

Find porn on 600+ video hosters as well all the xxx video tubes out there. If it is on the internet: we have it. Currently 27 million porn-streams indexed. Enjoy!

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: STRIPE.COM
Registry Domain ID: 891022_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2015-09-12T00:08:11Z
Creation Date: 1995-09-12T04:00:00Z
Registry Expiry Date: 2025-09-11T04:00:00Z
Registrar: SafeNames Ltd
Registrar IANA ID: 447
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverDeleteProhibited
Domain Status: serverTransferProhibited
Domain Status: serverUpdateProhibited
Name Server: NS-1087.AWSDNS-07.ORG
Name Server: NS-1882.AWSDNS-43.CO.UK
Name Server: NS-423.AWSDNS-52.COM
Name Server: NS-705.AWSDNS-24.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-15T16:23:23Z

Who hosts is hosted by, Inc. in Oregon, Boardman, United States, 97818. has an IP Address of and a hostname of and runs nginx web server. Web Server Information

Hosted IP Address:
Service, Inc.
Hosted Country:United StatesUS
Location Latitude:45.8696
Location Longitude:-119.688
Webserver Software:nginx
Google Map of 50,12

Websites Hosted on Same IP (i.e.

Stripe: Login

  1,962   $ 6,121,440.00

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 22 Nov 2016 14:39:53 GMT
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: X-Requested-With
X-Frame-Options: SAMEORIGIN
Strict-Transport-Security: max-age=31556926; includeSubDomains
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Page Title of


Meta Description of

Stripe is a suite of APIs that powers commerce for businesses of all sizes.

Meta Tags of

No tags found

Website Inpage Analysis for

H1 Headings:3
The new standard in online payments
Ready to get started? Get in touch, or create an account.
H2 Headings:7
The complete toolkit for internet business
Developers first
Always improving
Global scale
Introducing Sigma
Explore the docs
H3 Headings:16
Connect New
Sigma New
Works with Stripe
Full API Reference
API Status
Open Source
About Stripe
From the blog
H4 Headings:9
Get started
Popular topics
Sign up instantly
Request an invite
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:11
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

businessnumber 4242424242424242nglobalcvchelpradarawaitreferencesigmajobsatlasexpyear 2018ngetexpyearlatest123nstripe requirestripesktestbqokikjovbii2hlwgh4olfq2nnn numberunitedbusinessesweinternetcustomers12n expyearstripesncreatedevelopersmoren number 4242424242424242noursource2018n12nsupportnumberpricingcustomerbuildingplanrelayexpmonth 12ncvc 123napistartfirstpaymentsexploreaccountbestbalance4242424242424242n12n expyear 2018ntokenvarexpmonth 12n expyearworks with stripepaymenteveryupworksproductsyouryoudocumentationapi referenceconnectstriperequirestripesktestbqokikjovbii2hlwgh4olfq2nncurrencyexpmonthsignchargesubscriptionsnewpayamountmostblog

Longtail Keyword Density for

12n expyear 2018n3
expmonth 12n expyear3
n number 4242424242424242n3
works with stripe3
expmonth 12n3
12n expyear3
expyear 2018n3
cvc 123n3
number 4242424242424242n3
stripe requirestripesktestbqokikjovbii2hlwgh4olfq2nn3
n number3
api reference3
global3 Page Resources Breakdown Homepage Links Analysis

Alexa Traffic Rank for

Alexa Search Engine Traffic for

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States DNS Record Analysis DNS Lookup

Serial: 1
Refresh: 900
Retry: 900
Expire: 1209600
stripe.comMX86400Priority: 10
stripe.comMX86400Priority: 20
stripe.comMX86400Priority: 20
stripe.comMX86400Priority: 30
stripe.comMX86400Priority: 30
stripe.comTXT1800TXT: v=spf1 ip4:
ip4: ip4: ~all

What are the alternatives to

We know of 0 alternatives to

You can suggest alternatives to if you know of any. Alternatives Suggest an alternative

We don't know of any alternatives to this website.

If you know of any, please suggesting one.
