Stupid-machines.net  |  stupid-machines
Low trust score  | 
stupid-machines ist ein musikalisches Gebilde, welches sich ungefähr 2005 zusammen gefunden hat! stupid-machines steht für abstrakte elektronische Musik, zumeist drum 'n bass-ähnliche Songs aber auch...




Stupid-machines.net Website Information

Website Ranks & Scores for Stupid-machines.net

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:20%
DMOZ DMOZ Listing:No

Domain Information for Stupid-machines.net

Domain Registrar: CRONON AG
Registration Date:2006-11-01  1 decade 2 years 7 months ago
Last Modified:2014-11-02  4 years 7 months 2 weeks ago
Expiration Date:2015-11-01  3 years 7 months 2 weeks ago

Whois information for stupid-machines.net

Full Whois Lookup for Stupid-machines.net Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Stupid-machines.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: STUPID-MACHINES.NET
Registry Domain ID: 654092922_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.cronon.net
Registrar URL: http://www.cronon.net
Updated Date: 2017-11-02T07:19:41Z
Creation Date: 2006-11-01T14:45:02Z
Registry Expiry Date: 2018-11-01T13:45:02Z
Registrar: Cronon AG
Registrar IANA ID: 141
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +4930398020
Domain Status: ok https://icann.org/epp#ok
Name Server: DOCKS15.RZONE.DE
Name Server: SHADES12.RZONE.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-11-15T09:31:25Z

Who hosts Stupid-machines.net?

Stupid-machines.net is hosted by STRATO AG in Germany.
Stupid-machines.net has an IP Address of 81.169.145.89 and a hostname of w89.rzone.de.



Stupid-machines.net Web Server Information

Hosted IP Address:81.169.145.89
Hosted Hostname:w89.rzone.de
Service Provider:STRATO AG
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Not Applicable

HTTP Header Analysis for Stupid-machines.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sat, 17 Oct 2015 10:53:48 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close
Vary: Accept-Encoding
P3P: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy"
X-Tumblr-User: stupid-machines
X-Tumblr-Pixel-0: https://px.srvcs.tumblr.com/impixu?T=1445079228&J=eyJ0eXBlIjoidXJsIiwidXJsIjoiaHR0cDpcL1wvc3R1cGlkLW1hY2hpbmVzLnR1bWJsci5jb21cLyIsInJlcXR5cGUiOjAsInJvdXRlIjoiXC8ifQ==&U=GCKJCGPCFO&K=523737de1b8dfe624803e016669ec9b6d52aa0a7596cf7b179d6c30867ff9f22--https://px.srvcs.tumblr.com/impixu?T=1445079228&J=eyJ0eXBlIjoicG9zdCIsInVybCI6Imh0dHA6XC9cL3N0dXBpZC1tYWNoaW5lcy50dW1ibHIuY29tXC8iLCJyZXF0eXBlIjowLCJyb3V0ZSI6IlwvIiwicG9zdHMiOlt7InBvc3RpZCI6Ijc4MTg4MDk0Njc1IiwiYmxvZ2lkIjoiMzgxMTg0NjgiLCJzb3Vy
X-Tumblr-Pixel-1: Y2UiOjMzfSx7InBvc3RpZCI6Ijc4MTM4NDYwMDk4IiwiYmxvZ2lkIjoiMzgxMTg0NjgiLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjU4OTQ0NzQ4NDI0IiwiYmxvZ2lkIjoiMzgxMTg0NjgiLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjUxMzE0ODkzMjgyIiwiYmxvZ2lkIjoiMzgxMTg0NjgiLCJzb3VyY2UiOjMzfV19&U=HLPILHPEEB&K=c454a13a71d31b4d016e23e1c0844b47f449d7a334c9c27a4728f7ea6f5bc991
X-Tumblr-Pixel: 2
Link:; rel=icon
X-UA-Compatible: IE=Edge,chrome=1
Content-Encoding: gzip


Need to find out who hosts Stupid-machines.net?

Stupid-machines.net Free SEO Report

Website Inpage Analysis for Stupid-machines.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Stupid-machines.net

allowtransparencyx22truex22classx22soundcloudaudioplayerx22 widthx22500x22 heightx22500x22x3ex3ciframex3evortweetanalyticsframesrcsplitanalyticshtml0 functionsoundcloud disorderedseqsoundcloudifpermalinkframeborderx220x22 allowtransparencyx22truex22 classx22soundcloudaudioplayerx22listenerx3ciframevoncomments permalinkshare tweetjahrenframeborderx220x22commentswidthx22500x22 heightx22500x22x3ex3ciframex3eerzwoframeborderx220x22 allowtransparencyx22truex22falseshareclassx22soundcloudaudioplayerx22 widthx22500x22trueallowtransparencyx22truex22 classx22soundcloudaudioplayerx22 widthx22500x22listener usecapturevarallowtransparencyx22truex22 classx22soundcloudaudioplayerx22quelleclassx22soundcloudaudioplayerx22quelle soundcloudpermalink share tweetwidthx22500x22permalink shareisajaxanalyticsframesrcsplitanalyticshtml0comments permalink sharedisorderedsequsecaptureanalyticsiframeloadedistuserloggedinpostgamessagepostatmessage0functionstupidmachinesheightx22500x22x3ex3ciframex3e

Longtail Keyword Density for Stupid-machines.net

KeywordsOccurences
comments permalink share4
permalink share tweet4
frameborderx220x22 allowtransparencyx22truex22 classx22soundcloudaudioplayerx223
allowtransparencyx22truex22 classx22soundcloudaudioplayerx22 widthx22500x223
classx22soundcloudaudioplayerx22 widthx22500x22 heightx22500x22x3ex3ciframex3e3
permalink share4
comments permalink4
share tweet4
soundcloud disorderedseq4
frameborderx220x22 allowtransparencyx22truex223
allowtransparencyx22truex22 classx22soundcloudaudioplayerx223
classx22soundcloudaudioplayerx22 widthx22500x223
widthx22500x22 heightx22500x22x3ex3ciframex3e3
quelle soundcloud3
analyticsframesrcsplitanalyticshtml0 function3
listener usecapture3
var21
soundcloud7
function7
userloggedin6
analyticsiframeloaded6
stupid-machines5
05
vor4
jahren4
comments4
permalink4
share4
tweet4
disorderedseq4
analyticsframesrcsplitanalyticshtml04
isajax4
if4
quelle3
false3
listener3
postatmessage3
postgamessage3
true3
widthx22500x223
frameborderx220x223
allowtransparencyx22truex223
classx22soundcloudaudioplayerx223
heightx22500x22x3ex3ciframex3e3
von3
ist3
erzwo3
x3ciframe3
usecapture3

What are the nameservers for stupid-machines.net?

Stupid-machines.net Domain Nameserver Information

HostIP AddressCountry
docks15.rzone.de 81.169.146.25Germany Germany
shades12.rzone.de 85.214.0.242Germany Germany

Stupid-machines.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Stupid-machines.net is a scam?