Suncoastpartnership.org Favicon Suncoastpartnership.org

Suncoastpartnership.org Website Thumbnail
Checking...
Home | Suncoast Partnership

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet


Domain summary

Domain label
suncoastpartnership
Domain extension
org
Domain registered:
2006-01-29
Domain updated:
2020-10-30
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is suncoastpartnership.org ranked relative to other sites:

Percentage of visits to suncoastpartnership.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Suncoastpartnership.org registered?
A: Suncoastpartnership.org was registered 14 years, 9 months, 3 weeks, 6 days, 7 hours, 51 minutes, 38 seconds ago on Sunday, January 29, 2006.
Q: When was the WHOIS for Suncoastpartnership.org last updated?
A: The WHOIS entry was last updated 3 weeks, 5 days, 7 hours, 51 minutes, 38 seconds ago on Friday, October 30, 2020.
Q: What are Suncoastpartnership.org's nameservers?
A: DNS for Suncoastpartnership.org is provided by the following nameservers:
  • ns2.wixdns.net
  • ns3.wixdns.net
Q: Who is the registrar for the Suncoastpartnership.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Suncoastpartnership.org?
A: Suncoastpartnership.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Suncoastpartnership.org each day?
A: Suncoastpartnership.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Suncoastpartnership.org resolve to?
A: Suncoastpartnership.org resolves to the IPv4 address 23.236.62.147.
Q: In what country are Suncoastpartnership.org servers located in?
A: Suncoastpartnership.org has servers located in the United States.
Q: What webserver software does Suncoastpartnership.org use?
A: Suncoastpartnership.org is powered by webserver.
Q: Who hosts Suncoastpartnership.org?
A: Suncoastpartnership.org is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Suncoastpartnership.org worth?
A: Suncoastpartnership.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Suncoastpartnership.org?

Suncoastpartnership.org Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Suncoastpartnership.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Fri, 30 Oct 2020 09:59:18 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.suncoastpartnership.org/
x-wix-request-id: 1604051958.926569379898731429172
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: jeslxIFvDH4ulYwNNi 3Muwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgAmI6NXu6WfqLI/M7f8tcV,2d58ifebGbosy5xc FRalsM7yqqhFA6Z0KkvV0p aeT9FBYx0sSI0DisjcFBg2w0ey9D9BDwNPvHRetoRBeaRg==,2UNV7KOq4oGjA5 PKsX47EfZRIGggBRRQO6W0jtN ls=,m0j2EEknGIVUW/liY8BLLrirsZ1spqO hQFruvtAKWs=,qJS91GsscGZlb16v 8nwmLxTU5hwdYFFC6PByr6De1dGp/J3MBzgzU8QHrQuh4zQ,znxyTGNb715cyF9N4jtLDM1j9BGPRdatZhCAkzIsSPpGwdbblfPvfcZQjNUWH8m5
Cache-Control: no-cache
Expires: -1

Suncoastpartnership.org Domain Nameserver Information

HostIP AddressCountry
ns2.wixdns.net 216.239.36.100
ns3.wixdns.net 216.239.38.100


Need to find out who hosts Suncoastpartnership.org?


Domain Registration (WhoIs) information for Suncoastpartnership.org

 Domain Name: SUNCOASTPARTNERSHIP.ORG
Registry Domain ID: D113740886-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-01-30T15:28:53Z
Creation Date: 2006-01-29T00:04:27Z
Registry Expiry Date: 2021-01-29T00:04:27Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Suncoast Partnership to End Homelessness, Inc.
Registrant State/Province: Florida
Registrant Country: US
Name Server: NS2.WIXDNS.NET
Name Server: NS3.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-08-29T19:04:11Z

Suncoastpartnership.org Free SEO Report

Website Inpage Analysis for Suncoastpartnership.org

H1 Headings

0 :

H2 Headings

2 :
  1. Quick Links
  2. News and Notices:

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Suncoastpartnership.org

colornormal normalstylejbxxk3ufnavcontainersvgcontainer6stylekae0intflabelwrapperselectdataerrortrue10view1backgroundcolorrgba255rgba240 240calc100 980px 05rgba240selectfocustopautobottom0borderradius0255 255 1240 111backgroundcolorrgba255 255 25581borderradius0ol ulstylejbxxk3ufrepeaterbuttonshade backgroundcolorrgba191stylejbxxk3ufnavcontainerarrow6c3c1705solid0 06255 1marginleftselectdatapreviewerror192 192left10pxright10pxstylekae0intflinkfont normal normalbackgroundcolorrgba191 173249 1backgroundcolorrgba255stylejbxxk3ufrepeaterbuttongapper padding0fontnormal normalborderwidth2px borderstylesolidbordercolorrgba249 249ifstylejbxxk3ufnavcontainerarrowstylejbxxk3ufnavcontainerrightdirectionultxtnew olstrc1dataresponsive5backgroundcolorrgba191 173 127margin0lineheightnormalletterspacingnormalpositionfixed importantleftauto importantzindex50color ffffffrgba0 0rgba0255 255varcalc100ol1backgroundcolorrgba255 255open sanssansserif4pxstylejbxxk3ufrepeaterbuttonshade backgroundcolorrgba191 1734px rgba0 0borderstylesolidbordercolorrgba249strc1inlinecontentstylek9vvbw8ybgselectdatapreviewhoverpositionabsolutetop0right0bottom0left0selectdatapreviewerror stylejbxxk3ufnavcontainerarrow240 240 1margin0lineheightnormalletterspacingnormal txtnew7stylejbxxk3ufnavcontainerarrowstylejbxxk3ufnavcontainercenterdirection1 stylejbxxk3ufnavcontainertxtnew ulstylejbxxk3ufrepeaterbuttonshade borderradius4pxstylejbxxk3ufnavcontainerarrow stylejbxxk3ufnavcontainersvgcontainerfont normalstylejbxxk3ufnavcontainerrightdirectioncolor 6c3c17normal normal normalborderstylesolidbordercolorrgba249 249important0 0 06ease249 249backgroundcolorsanssansserifborderwidth2px borderstylesolidbordercolorrgba249normal249 249 1backgroundcolorrgba255255 1borderradius0249 1backgroundcolorrgba255 255txtnew240 240marginleft calc100backgroundcolorrgba191positionfixed importantleftautosuncoast0positionfixed31pxborderstylesolidbordercolorrgba249 249 249backgroundcolor 6c3c170s0 01px 4px rgba0click to view04s ease 0s4px rgba0borderwidth2pxlb1itemscontainerstylekae0intflabelstylek9vrlzeqbg1 2px04s2pxrgba240 240 240importantzindex50boxshadow0 1pxstylejbxxk3ufrepeaterbuttonlabel2calc100 980pxstylejbxxk3ufrepeaterbuttongapperstylejbxxk3ufnavcontainerleftdirectionstylejbxxk3ufnavcontainerselectdatapreviewfocusboxshadow0boxshadow0 1px 4px04s ease204 204ffffff06980px 05padding0solid rgba240borderradius4pxnormal 700selecthoversanssansserif color303030openstylejbxxk3ufrepeaterbuttonshadeease 0s9clickrgba0 0 0backgroundcolor ffffff173 127marginleft calc100 980pxstylejbxxk3ufrepeaterbuttondatastatedropfontnormalfontsolid rgba240 2401px 4px980pxultxtnewoldirrtl255 1 stylejbxxk3ufnavcontainercenterimportantleftauto4ul255 255 1borderradius0stylejbxxk3ufnavcontainercenterdirectioncolor303030importantleftauto importantzindex50open sanssansserif color303030stylejbxxk3ufnavcontainerarrowstylejbxxk3ufnavcontainerleftdirection

Longtail Keyword Density for Suncoastpartnership.org

KeywordsOccurences
calc100 980px 0514
margin-left calc100 980px14
font normal normal11
04s ease 0s11
open sanssans-serif color30303010
normal normal normal9
rgba240 240 2405
rgba0 0 05
240 240 15
255 255 15
positionfixed importantleftauto importantz-index504
background-colorrgba191 173 1274
style-jbxxk3ufrepeaterbuttonshade background-colorrgba191 1734
click to view4
border-stylesolidborder-colorrgba249 249 2494
border-width2px border-stylesolidborder-colorrgba249 2494
0 0 064
4px rgba0 04
1px 4px rgba04
249 1background-colorrgba255 2553
255 1 style-jbxxk3ufnavcontainer3
249 249 1background-colorrgba2553
solid rgba240 2403
box-shadow0 1px 4px3
255 255 1border-radius03
1background-colorrgba255 255 2553
normal normal21
980px 0514
open sanssans-serif14
calc100 980px14
margin-left calc10014
04s ease12
0 011
ease 0s11
font normal11
240 24010
sanssans-serif color30303010
255 2558
margin0line-heightnormalletter-spacingnormal txtnew7
1 style-jbxxk3ufnavcontainer5
rgba0 05
240 15
rgba240 2405
173 1275
255 15
positionfixed importantleftauto4
importantleftauto importantz-index504
txtnew ul4
204 2044
style-jbxxk3ufrepeaterbuttonshade background-colorrgba1914
background-colorrgba191 1734
249 2494
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
0 064
4px rgba04
1px 4px4
ol ul3
1 2px3
color ffffff3
ultxtnew ol3
solid rgba2403
255 1border-radius03
192 1923
style-jbxxk3ufrepeaterbuttonshade border-radius4px3
background-color ffffff3
color 6c3c173
style-jbxxk3ufrepeaterbuttongapper padding03
selectdata-previewerror style-jbxxk3ufnavcontainerarrow3
style-jbxxk3ufnavcontainerarrow style-jbxxk3ufnavcontainersvgcontainer3
background-color 6c3c173
fontnormal normal3
1background-colorrgba255 2553
249 1background-colorrgba2553
box-shadow0 1px3
normal 7003
background-color37
normal36
color36
028
positionabsolutetop0right0bottom0left021
120
txtnew18
216
open15
315
sanssans-serif14
980px14
margin-left14
calc10014
0514
style-jbxxk3ufnavcontainer13
ease12
04s12
style-jbxxk3ufrepeaterbuttonshade12
0s11
style-jbxxk3ufnavcontainerarrow11
font11
color30303011
ul10
solid9
48
58
important7
ol7
var7
margin0line-heightnormalletter-spacingnormal7
style-jbxxk3ufnavcontainerarrowstyle-jbxxk3ufnavcontainercenter-direction6
ffffff6
style-jbxxk3ufnavcontainerarrowstyle-jbxxk3ufnavcontainerright-direction6
66
6c3c176
style-jbxxk3ufnavcontainerarrowstyle-jbxxk3ufnavcontainerleft-direction6
1border-radius06
75
if5
suncoast5
rgba2405
style-jbxxk3ufrepeaterbuttongapper5
rgba05
ultxtnew5
border-radius05
85
click5
background-colorrgba1914
lb1itemscontainer4
importantz-index504
positionfixed4
importantleftauto4
topautobottom04
94
style-kae0intflabelwrapper4
style-kae0intflabel4
view4
style-jbxxk3ufrepeaterbuttondata-statedrop4
style-jbxxk3ufrepeaterbuttonlabel4
padding04
1px4
4px4
064
border-width2px4
border-stylesolidborder-colorrgba2494
border-radius4px4
box-shadow03
1background-colorrgba2553
2px3
style-kae0intflink3
fontnormal3
strc1data-responsive3
strc1inlinecontent3
oldirrtl3
103
style-jbxxk3ufnavcontainersvgcontainer3
style-jbxxk3ufnavcontainerleft-direction3
selecthover3
selectdata-previewhover3
style-k9vrlzeqbg3
left10pxright10px3
selectfocus3
style-k9vvbw8ybg3
selectdata-previewfocus3
selectdata-errortrue3
selectdata-previewerror3
style-jbxxk3ufnavcontainercenter-direction3
center3
style-jbxxk3ufnavcontainerright-direction3

Suncoastpartnership.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Sunco-cncs.com
sunco-cncs.com -&nbspsunco cncs Resources and Information.
Sunco.cocolog-nifty.com
~サンコー電商 有限会社~
Sunco.com.au
Home - Sunco : Sunco
Sunco.store
sunco.store - Registered at Namecheap.com
Suncoaching.network
403 - Forbidden Error
Suncoal.net
suncoal.net
Suncoamerica.com
SUNCO AMERICA LLC – Sunco America LLC

Recently Updated Websites

Teknosarf.net 1 minute 48 seconds ago.Amazon.com.tr 2 minutes 11 seconds ago.Nefesteknikleri.com 4 minutes 4 seconds ago.Yogasangeeta.org 4 minutes 12 seconds ago.Sankirtasiye.com.tr 5 minutes 9 seconds ago.Tkm-consultores.com 10 minutes 37 seconds ago.Ourgreenspot.com 10 minutes 41 seconds ago.Kenzotakashima.net 10 minutes 54 seconds ago.Aplicacionesicaz.com 10 minutes 58 seconds ago.Psicotestperu.com 14 minutes 33 seconds ago.Quicksupportlink.com 14 minutes 38 seconds ago.Affiliates.maxbounty.com 16 minutes 50 seconds ago.Minstrelbanjo.com 19 minutes 21 seconds ago.Tv-tastic.com 19 minutes 30 seconds ago.Allstatevehicles.com 19 minutes 35 seconds ago.Ofisturka.com 19 minutes 43 seconds ago.Gynowear.com 19 minutes 56 seconds ago.Obtruder.com 20 minutes ago.Bestmedicaldegrees.com 20 minutes 1 second ago.Perfectpassionllc.com 20 minutes 10 seconds ago.Verjus.latinowebs.com 20 minutes 10 seconds ago.Lbyc.org 20 minutes 19 seconds ago.Glenndpaul.com 20 minutes 24 seconds ago.Tecnologialdia.com 20 minutes 24 seconds ago.Niceperfectass.com 20 minutes 26 seconds ago.Childrenconference.com 20 minutes 35 seconds ago.Hulan777.com 20 minutes 35 seconds ago.Transparentstorage.org 20 minutes 38 seconds ago.Melissamayntz.com 20 minutes 41 seconds ago.Lipinshangcheng.com 20 minutes 44 seconds ago.