Supergames.lt

Checking...
Žaidimai, Esportas, Forumas - 🎮 SuperGames.lt
Low trust score
 | 
Add a review Change category Claim this site
Didžiausias žaidėjų portalas ir forumas Lietuvoje - SuperGames.lt. Žaidimai, esportas (e-sportas), diskusijos, konkursai, naujienos.


Domain summary

Domain label
supergames
Domain extension
lt
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is supergames.lt ranked relative to other sites:

Percentage of visits to supergames.lt from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Supergames.lt registered?
A: Supergames.lt was registered 1 week, 5 days, 11 hours, 29 minutes, 46 seconds ago on Saturday, September 12, 2020.
Q: When was the WHOIS for Supergames.lt last updated?
A: The WHOIS entry was last updated 1 week, 5 days, 11 hours, 29 minutes, 46 seconds ago on Saturday, September 12, 2020.
Q: What are Supergames.lt's nameservers?
A: DNS for Supergames.lt is provided by the following nameservers:
  • scott.ns.cloudflare.com
  • emma.ns.cloudflare.com
Q: Who is the registrar for the Supergames.lt domain?
A: The domain has been registered at .
Q: What is the traffic rank for Supergames.lt?
A: Supergames.lt has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Supergames.lt each day?
A: Supergames.lt receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Supergames.lt resolve to?
A: Supergames.lt resolves to the IPv4 address 172.67.156.42.
Q: In what country are Supergames.lt servers located in?
A: Supergames.lt has servers located in the United States.
Q: What webserver software does Supergames.lt use?
A: Supergames.lt is powered by CloudFlare webserver.
Q: Who hosts Supergames.lt?
A: Supergames.lt is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Supergames.lt worth?
A: Supergames.lt has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Supergames.lt?

Supergames.lt Hosting Provider Information

Hosted IP Address:172.67.156.42
Hosted Hostname:172.67.156.42
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Supergames.lt

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 12 Sep 2020 12:31:26 GMT
Content-Type: ;charset=UTF-8
Content-Length: 0
Connection: keep-alive
X-IPS-LoggedIn: 0
Vary: cookie
X-XSS-Protection: 0
X-Frame-Options: sameorigin
Location: https://www.supergames.lt/
Cache-Control: no-cache, no-store, must-revalidate
Pragma: no-cache
Expires: 0
CF-Cache-Status: DYNAMIC
cf-request-id: 0523e59aad000000756832d200000001
Server: cloudflare
CF-RAY: 5d19a53dede70075-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Supergames.lt Domain Nameserver Information

HostIP AddressCountry
scott.ns.cloudflare.com 108.162.193.230
emma.ns.cloudflare.com 173.245.58.112


Need to find out who hosts Supergames.lt?


WhoIs information for Supergames.lt

Supergames.lt Free SEO Report

Website Inpage Analysis for Supergames.lt

H1 Headings

1 :
  1. Žaidimai, Esportas, Forumas

H2 Headings

9 :
  1. Sveikinimas su naujais mokslo metais ir konkurso laimėtojas
  2. Nemokamas "Hitman" Epic Games platformoje!
  3. Rockstar išleido "Los Santos Summer Special" atnaujinimą, skirtą GTA: Online
  4. Sveikinimas su naujais mokslo metais ir konkurso laimėtojas
  5. Žaidimai
  6. Technika ir programinė įranga
  7. Konsolės
  8. Įvairios diskusijos
  9. SuperGames.lt

H3 Headings

11 :
  1. Naujausios temos
  2. Aktyvių narių:   43 narių , 0 slaptų, 70 svečių (Pilnas sąrašas)
  3. Naujausi pranešimai forume
  4. Naujausi būsenos atnaujinimai
  5. Populiariausi nariai
  6. Forumo statistika
  7. Šiandien gimtadienį švencia
  8. Apie SuperGames
  9. Kategorijos
  10. Naudingos nuorodos
  11. Social

H4 Headings

50 :
  1. Prisijungti
  2. Dėl GTA V car mods
  3. ieškau Rust team
  4. parduodu Parduodu lol acc euw
  5. Ką manot apie cloud mining?
  6. Problema su discordu
  7. Kiek jaunimas praleidžia prie kompiuterio ?
  8. Žaidimų naujienos
  9. Veiksmo žaidimai
  10. Smėlio dėžės žaidimai
  11. MMORPG žaidimai
  12. Naršykliniai žaidimai
  13. Telefonų žaidimai
  14. Lenktynių žaidimai
  15. Strateginiai žaidimai
  16. Simuliatoriniai žaidimai
  17. Sporto žaidimai
  18. Azartiniai žaidimai
  19. Kiti žaidimai
  20. Žaidimų kūrimas
  21. Žaidimų programos
  22. Technikos naujienos
  23. Kompiuterių gedimai ir pagalba
  24. Stacionarūs kompiuteriai
  25. Nešiojamieji kompiuteriai
  26. Planšetiniai kompiuteriai
  27. Kompiuterių spartinimas
  28. Telefonai ir kiti gadgetai
  29. Programinė įranga
  30. Kita technika
  31. Klaidos
  32. Hostingas ir serveriai
  33. PlayStation konsolės
  34. Xbox konsolės
  35. Nintendo konsolės
  36. Apie viską
  37. Verslas
  38. Forumo turgus
  39. Steam
  40. Sveikinimai ir prisistatymai
  41. Bendruomenės konkursai ir dalybos
  42. Įdomios nuorodos, reklama
  43. GFX
  44. VFX
  45. Tinklapių kūrimas
  46. Programavimas
  47. Forumo taisyklės   (58.382 paspaudimų)
  48. Naujienos ir informacija
  49. Klausimai ir pasiūlymai
  50. Bendruomenė

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

102 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3936587-16

Links - Internal

466:
  1. No text
    https://www.supergames.lt/discover/
  2. No text
    https://www.supergames.lt/search/
  3. No text
    https://www.supergames.lt/
  4. Turite paskyrą? Prisijunkite  
    http://supergames.lt//www.supergames.lt/login/
  5. Pamiršote savo paskyros slaptažodį?
    https://www.supergames.lt/lostpassword/
  6. Registruotis
    https://www.supergames.lt/register/
  7. No text
    https://www.supergames.lt
  8. Naujienos
    https://www.supergames.lt/news/
  9. Forumas
    https://www.supergames.lt
  10. Nariai
    https://www.supergames.lt/search/?type=core_members
  11. Ateities planai
    https://www.supergames.lt/ateities-planai/
  12. Atsiliepimai
    https://www.supergames.lt/feedback/
  13. Apdovanojimai
    https://www.supergames.lt/awards/
  14. Kalendorius
    https://www.supergames.lt/calendar/
  15. Prisijungę nariai
    https://www.supergames.lt/online/
  16. SuperGames Discord
    https://www.supergames.lt/discord/invite/general/
  17. Forumo taisyklės
    https://www.supergames.lt/terms/
  18. Visa veikla
    https://www.supergames.lt/discover/
  19. Pradžia
    https://www.supergames.lt/
  20. No text
    https://www.supergames.lt/news/supergames/sveikinimas-su-naujais-mokslo-metais-ir-konkurso-laimetojas/
  21. Sveikinimas su naujais mokslo metais ir konkurso laimėtojas
    https://www.supergames.lt/news/supergames/sveikinimas-su-naujais-mokslo-metais-ir-konkurso-laimetojas/
  22. No text
    https://www.supergames.lt/news/zaidimu-naujienos/nemokamas-hitman-epic-games-platformoje-r190/
  23. Nemokamas "Hitman" Epic Games platformoje!
    https://www.supergames.lt/news/zaidimu-naujienos/nemokamas-hitman-epic-games-platformoje-r190/
  24. No text
    https://www.supergames.lt/news/zaidimu-naujienos/rockstar-isleido-los-santos-summer-special-atnaujinima-skirta-gta-online-r/
  25. Rockstar išleido "Los Santos Summer Special" atnaujinimą, skirtą GTA: Online
    https://www.supergames.lt/news/zaidimu-naujienos/rockstar-isleido-los-santos-summer-special-atnaujinima-skirta-gta-online-r/
  26. Įkelti daugiau straipsnių
    https://www.supergames.lt/news/
  27. Daugiau straipsnių
    https://www.supergames.lt/news/
  28. Dėl GTA V car mods
    https://www.supergames.lt/topic/327237-d%C4%97l-gta-v-car-mods/
  29. ᴍᴏᴏɴʟɪɢʜᴛ
    https://www.supergames.lt/profile/17403-%E1%B4%8D%E1%B4%8F%E1%B4%8F%C9%B4%CA%9F%C9%AA%C9%A2%CA%9C%E1%B4%9B/
  30. Apie viską
    https://www.supergames.lt/forum/12-apie-visk%C4%85/
  31. No text
    https://www.supergames.lt/profile/17403-%E1%B4%8D%E1%B4%8F%E1%B4%8F%C9%B4%CA%9F%C9%AA%C9%A2%CA%9C%E1%B4%9B/
  32. prieš 52 minutes(-čių)
    https://www.supergames.lt/topic/327237-d%C4%97l-gta-v-car-mods/?do=getLastComment
  33. ieškau Rust team
    https://www.supergames.lt/topic/327236-ie%C5%A1kau-rust-team/
  34. Routeh
    https://www.supergames.lt/profile/56744-routeh/
  35. Rust
    https://www.supergames.lt/forum/424-rust/
  36. No text
    https://www.supergames.lt/profile/56744-routeh/
  37. prieš 2 valandas(-ų)
    https://www.supergames.lt/topic/327236-ie%C5%A1kau-rust-team/?do=getLastComment
  38. parduodu
    https://www.supergames.lt/search/?tags=parduodu
  39. Parduodu lol acc euw
    https://www.supergames.lt/topic/327235-parduodu-lol-acc-euw/
  40. Justas55
    https://www.supergames.lt/profile/49185-justas55/
  41. EUW
    https://www.supergames.lt/forum/236-euw/
  42. No text
    https://www.supergames.lt/profile/49185-justas55/
  43. prieš 2 valandas(-ų)
    https://www.supergames.lt/topic/327235-parduodu-lol-acc-euw/?do=getLastComment
  44. Ką manot apie cloud mining?
    https://www.supergames.lt/topic/327234-k%C4%85-manot-apie-cloud-mining/
  45. Denas.
    https://www.supergames.lt/profile/53689-denas/
  46. Verslas
    https://www.supergames.lt/forum/486-verslas/
  47. No text
    https://www.supergames.lt/profile/55714-michael_scott/
  48. Michael_Scott
    https://www.supergames.lt/profile/55714-michael_scott/
  49. prieš 2 valandas(-ų)
    https://www.supergames.lt/topic/327234-k%C4%85-manot-apie-cloud-mining/?do=getLastComment
  50. Problema su discordu
    https://www.supergames.lt/topic/327200-problema-su-discordu/
  51. Yankee
    https://www.supergames.lt/profile/54925-yankee/
  52. Klaidos
    https://www.supergames.lt/forum/296-klaidos/
  53. No text
    https://www.supergames.lt/profile/46784-%E3%82%A8%E3%83%BC%E3%82%B7%E3%83%B3/
  54. エーシン
    https://www.supergames.lt/profile/46784-%E3%82%A8%E3%83%BC%E3%82%B7%E3%83%B3/
  55. prieš 1 valandą
    https://www.supergames.lt/topic/327200-problema-su-discordu/?do=getLastComment
  56. Kiek jaunimas praleidžia prie kompiuterio ?
    https://www.supergames.lt/topic/327198-kiek-jaunimas-praleid%C5%BEia-prie-kompiuterio/
  57. V4PSVA
    https://www.supergames.lt/profile/58064-v4psva/
  58. No text
    https://www.supergames.lt/profile/59660-dominique/
  59. Dominique
    https://www.supergames.lt/profile/59660-dominique/
  60. prieš 5 valandas(-ų)
    https://www.supergames.lt/topic/327198-kiek-jaunimas-praleid%C5%BEia-prie-kompiuterio/?do=getLastComment
  61. Sukurti naują temą
    https://www.supergames.lt/startTopic/
  62. Žaidimai
    https://www.supergames.lt/forum/108-%C5%BEaidimai/
  63. Žaidimų naujienos
    https://www.supergames.lt/forum/35-%C5%BEaidim%C5%B3-naujienos/
  64. No text
    https://www.supergames.lt/profile/49023-m%C4%97sainis/
  65. [Steam] Nemokami Steam žai…
    https://www.supergames.lt/topic/323371-steam-nemokami-steam-%C5%BEaidimai/?do=getNewComment
  66. Mėsainis
    https://www.supergames.lt/profile/49023-m%C4%97sainis/
  67. Rugsėjo 6
    https://www.supergames.lt/topic/323371-steam-nemokami-steam-%C5%BEaidimai/?do=getLastComment
  68. Veiksmo žaidimai
    https://www.supergames.lt/forum/8-veiksmo-%C5%BEaidimai/
  69. Counter-Strike 1.6
    https://www.supergames.lt/forum/13-counter-strike-16/
  70. GTA SA:MP
    https://www.supergames.lt/forum/58-gta-samp/
  71. GTA V
    https://www.supergames.lt/forum/417-gta-v/
  72. Counter-Strike Global Offensive
    https://www.supergames.lt/forum/272-counter-strike-global-offensive/
  73. PlayerUnknown's Battlegrounds
    https://www.supergames.lt/forum/459-playerunknowns-battlegrounds/
  74. Counter-Strike: Source
    https://www.supergames.lt/forum/88-counter-strike-source/
  75. Payday
    https://www.supergames.lt/forum/329-payday/
  76. ieškau Rust team
    https://www.supergames.lt/topic/327236-ie%C5%A1kau-rust-team/?do=getNewComment
  77. Smėlio dėžės žaidimai
    https://www.supergames.lt/forum/7-sm%C4%97lio-d%C4%97%C5%BE%C4%97s-%C5%BEaidimai/
  78. Minecraft
    https://www.supergames.lt/forum/204-minecraft/
  79. Garry's Mod
    https://www.supergames.lt/forum/271-garrys-mod/
  80. No text
    https://www.supergames.lt/profile/43884-shockwave/
  81. Ieškomas asmuo kuris dirbt…
    https://www.supergames.lt/topic/327002-ie%C5%A1komas-asmuo-kuris-dirbtu-prie-minecraft-serverio/?do=getNewComment
  82. ShockWave!
    https://www.supergames.lt/profile/43884-shockwave/
  83. prieš 1 valandą
    https://www.supergames.lt/topic/327002-ie%C5%A1komas-asmuo-kuris-dirbtu-prie-minecraft-serverio/?do=getLastComment
  84. MMORPG žaidimai
    https://www.supergames.lt/forum/9-mmorpg-%C5%BEaidimai/
  85. Lineage 2
    https://www.supergames.lt/forum/34-lineage-2/
  86. Runescape
    https://www.supergames.lt/forum/150-runescape/
  87. MU-Online
    https://www.supergames.lt/forum/111-mu-online/
  88. World Of Warcraft
    https://www.supergames.lt/forum/41-world-of-warcraft/
  89. No text
    https://www.supergames.lt/profile/24061-docentas/
  90. Grand Mu online SEASON 8 S…
    https://www.supergames.lt/topic/327162-grand-mu-online-season-8-soon/?do=getNewComment
  91. Docentas
    https://www.supergames.lt/profile/24061-docentas/
  92. prieš 16 minutes(-čių)
    https://www.supergames.lt/topic/327162-grand-mu-online-season-8-soon/?do=getLastComment
  93. Naršykliniai žaidimai
    https://www.supergames.lt/forum/110-nar%C5%A1ykliniai-%C5%BEaidimai/
  94. Travian
    https://www.supergames.lt/forum/263-travian/
  95. No text
    https://www.supergames.lt/profile/40467-grazvydas18/
  96. Ieškau kas sukurtu botą
    https://www.supergames.lt/topic/327009-ie%C5%A1kau-kas-sukurtu-bot%C4%85/?do=getNewComment
  97. Grazvydas18
    https://www.supergames.lt/profile/40467-grazvydas18/
  98. Pirmadienis, 14:38
    https://www.supergames.lt/topic/327009-ie%C5%A1kau-kas-sukurtu-bot%C4%85/?do=getLastComment
  99. Telefonų žaidimai
    https://www.supergames.lt/forum/78-telefon%C5%B3-%C5%BEaidimai/
  100. iOS žaidimai
    https://www.supergames.lt/forum/247-ios-%C5%BEaidimai/
  101. Android žaidimai
    https://www.supergames.lt/forum/180-android-%C5%BEaidimai/
  102. Windows Phone žaidimai
    https://www.supergames.lt/forum/260-windows-phone-%C5%BEaidimai/
  103. Java žaidimai
    https://www.supergames.lt/forum/80-java-%C5%BEaidimai/
  104. No text
    https://www.supergames.lt/profile/46630-easydrunk/
  105. Rise of Civilizations
    https://www.supergames.lt/topic/309828-rise-of-civilizations/?do=getNewComment
  106. easydrunk.
    https://www.supergames.lt/profile/46630-easydrunk/
  107. prieš 4 valandas(-ų)
    https://www.supergames.lt/topic/309828-rise-of-civilizations/?do=getLastComment
  108. Lenktynių žaidimai
    https://www.supergames.lt/forum/54-lenktyni%C5%B3-%C5%BEaidimai/
  109. Need For Speed
    https://www.supergames.lt/forum/261-need-for-speed/
  110. Live For Speed
    https://www.supergames.lt/forum/428-live-for-speed/
  111. No text
    https://www.supergames.lt/profile/57622-n1ightmare/
  112. LFS Cruise insim
    https://www.supergames.lt/topic/240583-lfs-cruise-insim/?do=getNewComment
  113. N1ightmare
    https://www.supergames.lt/profile/57622-n1ightmare/
  114. Rugpjūčio 27
    https://www.supergames.lt/topic/240583-lfs-cruise-insim/?do=getLastComment
  115. Strateginiai žaidimai
    https://www.supergames.lt/forum/10-strateginiai-%C5%BEaidimai/
  116. League of Legends
    https://www.supergames.lt/forum/225-league-of-legends/
  117. World of Tanks
    https://www.supergames.lt/forum/294-world-of-tanks/
  118. Dota 2
    https://www.supergames.lt/forum/312-dota-2/
  119. No text
    https://www.supergames.lt/profile/37446-ernestasj/
  120. Ar įmanoma? Age of Empires…
    https://www.supergames.lt/topic/325806-ar-%C4%AFmanoma-age-of-empires-iii/?do=getNewComment
  121. ErnestasJ'
    https://www.supergames.lt/profile/37446-ernestasj/
  122. Rugsėjo 2
    https://www.supergames.lt/topic/325806-ar-%C4%AFmanoma-age-of-empires-iii/?do=getLastComment
  123. Simuliatoriniai žaidimai
    https://www.supergames.lt/forum/56-simuliatoriniai-%C5%BEaidimai/
  124. Euro / American Truck Simulator
    https://www.supergames.lt/forum/430-euro-american-truck-simulator/
  125. Farming Simulator
    https://www.supergames.lt/forum/483-farming-simulator/
  126. No text
    https://www.supergames.lt/profile/51159-hax0r/
  127. fs 19 modai
    https://www.supergames.lt/topic/327145-fs-19-modai/?do=getNewComment
  128. haX0r
    https://www.supergames.lt/profile/51159-hax0r/
  129. Ketvirtadienis, 12:11
    https://www.supergames.lt/topic/327145-fs-19-modai/?do=getLastComment
  130. Sporto žaidimai
    https://www.supergames.lt/forum/181-sporto-%C5%BEaidimai/
  131. NBA
    https://www.supergames.lt/forum/293-nba/
  132. FIFA
    https://www.supergames.lt/forum/321-fifa/
  133. Sporto žaidimų dinastijos
    https://www.supergames.lt/forum/295-sporto-%C5%BEaidim%C5%B3-dinastijos/
  134. No text
    https://www.supergames.lt/profile/44681-newyorkas/
  135. nba 2k20 configo išsaugoji…
    https://www.supergames.lt/topic/326800-nba-2k20-configo-i%C5%A1saugojimas/?do=getNewComment
  136. newyorkas
    https://www.supergames.lt/profile/44681-newyorkas/
  137. Rugpjūčio 25
    https://www.supergames.lt/topic/326800-nba-2k20-configo-i%C5%A1saugojimas/?do=getLastComment
  138. Azartiniai žaidimai
    https://www.supergames.lt/forum/179-azartiniai-%C5%BEaidimai/
  139. No text
    https://www.supergames.lt/profile/56061-ricci/
  140. Ricci
    https://www.supergames.lt/profile/56061-ricci/
  141. Kiti žaidimai
    https://www.supergames.lt/forum/313-kiti-%C5%BEaidimai/
  142. No text
    https://www.supergames.lt/profile/60214-xideojs/
  143. Warzone klaida, kaip sutva…
    https://www.supergames.lt/topic/327157-warzone-klaida-kaip-sutvarkyti/?do=getNewComment
  144. xideojs
    https://www.supergames.lt/profile/60214-xideojs/
  145. Ketvirtadienis, 15:44
    https://www.supergames.lt/topic/327157-warzone-klaida-kaip-sutvarkyti/?do=getLastComment
  146. Žaidimų kūrimas
    https://www.supergames.lt/forum/177-%C5%BEaidim%C5%B3-k%C5%ABrimas/
  147. No text
    https://www.supergames.lt/profile/13712-justasxz/
  148. 2D Top Down Binding of Isa…
    https://www.supergames.lt/topic/326701-2d-top-down-binding-of-isaac-inspired-%C5%BEaidimas/?do=getNewComment
  149. justasxz
    https://www.supergames.lt/profile/13712-justasxz/
  150. Rugpjūčio 19
    https://www.supergames.lt/topic/326701-2d-top-down-binding-of-isaac-inspired-%C5%BEaidimas/?do=getLastComment
  151. Žaidimų programos
    https://www.supergames.lt/forum/77-%C5%BEaidim%C5%B3-programos/
  152. No text
    https://www.supergames.lt/profile/48260-krisius/
  153. Kaip greičiau užfiksuoti g…
    https://www.supergames.lt/topic/324880-kaip-grei%C4%8Diau-u%C5%BEfiksuoti-geriausias-akimirkas/?do=getNewComment
  154. Krisius
    https://www.supergames.lt/profile/48260-krisius/
  155. Gegužės 8
    https://www.supergames.lt/topic/324880-kaip-grei%C4%8Diau-u%C5%BEfiksuoti-geriausias-akimirkas/?do=getLastComment
  156. Technika ir programinė įranga
    https://www.supergames.lt/forum/185-technika-ir-programin%C4%97-%C4%AFranga/
  157. Technikos naujienos
    https://www.supergames.lt/forum/194-technikos-naujienos/
  158. No text
    https://www.supergames.lt/profile/47959-kakas69/
  159. Pristatytos RTX 30 serijos…
    https://www.supergames.lt/topic/326959-pristatytos-rtx-30-serijos-vaizdo-plok%C5%A1t%C4%97s/?do=getNewComment
  160. Kakas69
    https://www.supergames.lt/profile/47959-kakas69/
  161. Rugsėjo 5
    https://www.supergames.lt/topic/326959-pristatytos-rtx-30-serijos-vaizdo-plok%C5%A1t%C4%97s/?do=getLastComment
  162. Kompiuterių gedimai ir pagalba
    https://www.supergames.lt/forum/219-kompiuteri%C5%B3-gedimai-ir-pagalba/
  163. No text
    https://www.supergames.lt/profile/48589-kukme1steris/
  164. Keletą klausimų dėl mikrof…
    https://www.supergames.lt/topic/327191-kelet%C4%85-klausim%C5%B3-d%C4%97l-mikrofono/?do=getNewComment
  165. Kukme1steris.
    https://www.supergames.lt/profile/48589-kukme1steris/
  166. prieš 20 valandas(-ų)
    https://www.supergames.lt/topic/327191-kelet%C4%85-klausim%C5%B3-d%C4%97l-mikrofono/?do=getLastComment
  167. Stacionarūs kompiuteriai
    https://www.supergames.lt/forum/186-stacionar%C5%ABs-kompiuteriai/
  168. Surinkite man kompiuterį!
    https://www.supergames.lt/forum/457-surinkite-man-kompiuter%C4%AF/
  169. Kompiuterio korpusas
    https://www.supergames.lt/topic/327153-kompiuterio-korpusas/?do=getNewComment
  170. Ketvirtadienis, 17:00
    https://www.supergames.lt/topic/327153-kompiuterio-korpusas/?do=getLastComment
  171. Nešiojamieji kompiuteriai
    https://www.supergames.lt/forum/187-ne%C5%A1iojamieji-kompiuteriai/
  172. No text
    https://www.supergames.lt/profile/13316-es/
  173. Patarkite laptopą
    https://www.supergames.lt/topic/327190-patarkite-laptop%C4%85/?do=getNewComment
  174. ES.^
    https://www.supergames.lt/profile/13316-es/
  175. prieš 20 valandas(-ų)
    https://www.supergames.lt/topic/327190-patarkite-laptop%C4%85/?do=getLastComment
  176. Planšetiniai kompiuteriai
    https://www.supergames.lt/forum/262-plan%C5%A1etiniai-kompiuteriai/
  177. Plansete iki 85e
    https://www.supergames.lt/topic/327087-plansete-iki-85e/?do=getNewComment
  178. Sekmadienis, 13:44
    https://www.supergames.lt/topic/327087-plansete-iki-85e/?do=getLastComment
  179. Kompiuterių spartinimas
    https://www.supergames.lt/forum/188-kompiuteri%C5%B3-spartinimas/
  180. No text
    https://www.supergames.lt/profile/36157-darrel/
  181. Ryzen 5 2600 Clock
    https://www.supergames.lt/topic/326707-ryzen-5-2600-clock/?do=getNewComment
  182. darrel.
    https://www.supergames.lt/profile/36157-darrel/
  183. Rugpjūčio 30
    https://www.supergames.lt/topic/326707-ryzen-5-2600-clock/?do=getLastComment
  184. Telefonai ir kiti gadgetai
    https://www.supergames.lt/forum/190-telefonai-ir-kiti-gadgetai/
  185. Ką pasirinkti?
    https://www.supergames.lt/forum/460-k%C4%85-pasirinkti/
  186. dreba kamera
    https://www.supergames.lt/topic/326958-dreba-kamera/?do=getNewComment
  187. Rugsėjo 3
    https://www.supergames.lt/topic/326958-dreba-kamera/?do=getLastComment
  188. Programinė įranga
    https://www.supergames.lt/forum/189-programin%C4%97-%C4%AFranga/
  189. No text
    https://www.supergames.lt/profile/48703-th3skeletas/
  190. Ieškau word, excel
    https://www.supergames.lt/topic/326982-ie%C5%A1kau-word-excel/?do=getNewComment
  191. Th3Skeletas
    https://www.supergames.lt/profile/48703-th3skeletas/
  192. Rugsėjo 5
    https://www.supergames.lt/topic/326982-ie%C5%A1kau-word-excel/?do=getLastComment
  193. Kita technika
    https://www.supergames.lt/forum/191-kita-technika/
  194. Ausinių rekomendacija
    https://www.supergames.lt/topic/327194-ausini%C5%B3-rekomendacija/?do=getNewComment
  195. prieš 1 valandą
    https://www.supergames.lt/topic/327194-ausini%C5%B3-rekomendacija/?do=getLastComment
  196. Problema su discordu
    https://www.supergames.lt/topic/327200-problema-su-discordu/?do=getNewComment
  197. Hostingas ir serveriai
    https://www.supergames.lt/forum/336-hostingas-ir-serveriai/
  198. Paslaugų tiekėjai
    https://www.supergames.lt/forum/337-paslaug%C5%B3-tiek%C4%97jai/
  199. No text
    https://www.supergames.lt/profile/59626-saab/
  200. ✪[VPSnet.lt] Profesionalūs…
    https://www.supergames.lt/topic/292557-%E2%9C%AAvpsnetlt-profesional%C5%ABs-galingi-ssd-vps-serveriai-nuo-199-%E2%82%AC-m%C4%97n-1gb-ram-30-dien%C5%B3-pinig%C5%B3-gr%C4%85%C5%BEinimo-garantija%E2%9C%AA/?do=getNewComment
  201. //Saab//
    https://www.supergames.lt/profile/59626-saab/
  202. Vakar 10:40
    https://www.supergames.lt/topic/292557-%E2%9C%AAvpsnetlt-profesional%C5%ABs-galingi-ssd-vps-serveriai-nuo-199-%E2%82%AC-m%C4%97n-1gb-ram-30-dien%C5%B3-pinig%C5%B3-gr%C4%85%C5%BEinimo-garantija%E2%9C%AA/?do=getLastComment
  203. Konsolės
    https://www.supergames.lt/forum/109-konsol%C4%97s/
  204. PlayStation konsolės
    https://www.supergames.lt/forum/195-playstation-konsol%C4%97s/
  205. No text
    https://www.supergames.lt/profile/43371-ivron/
  206. Ps5 kaina
    https://www.supergames.lt/topic/325725-ps5-kaina/?do=getNewComment
  207. iVron
    https://www.supergames.lt/profile/43371-ivron/
  208. Liepos 20
    https://www.supergames.lt/topic/325725-ps5-kaina/?do=getLastComment
  209. Xbox konsolės
    https://www.supergames.lt/forum/196-xbox-konsol%C4%97s/
  210. ideali konsolė
    https://www.supergames.lt/topic/326413-ideali-konsol%C4%97/?do=getNewComment
  211. Rugpjūčio 1
    https://www.supergames.lt/topic/326413-ideali-konsol%C4%97/?do=getLastComment
  212. Nintendo konsolės
    https://www.supergames.lt/forum/178-nintendo-konsol%C4%97s/
  213. No text
    https://www.supergames.lt/profile/58261-worden/
  214. Nintendo WII atrišta konso…
    https://www.supergames.lt/topic/322807-nintendo-wii-atri%C5%A1ta-konsol%C4%97/?do=getNewComment
  215. worden
    https://www.supergames.lt/profile/58261-worden/
  216. Vasario 26
    https://www.supergames.lt/topic/322807-nintendo-wii-atri%C5%A1ta-konsol%C4%97/?do=getLastComment
  217. Įvairios diskusijos
    https://www.supergames.lt/forum/11-%C4%AFvairios-diskusijos/
  218. Sportas
    https://www.supergames.lt/forum/467-sportas/
  219. Muzika
    https://www.supergames.lt/forum/334-muzika/
  220. Filmai
    https://www.supergames.lt/forum/335-filmai/
  221. Atsiliepimai
    https://www.supergames.lt/forum/454-atsiliepimai/
  222. Studijos ir mokslas
    https://www.supergames.lt/forum/487-studijos-ir-mokslas/
  223. Dėl GTA V car mods
    https://www.supergames.lt/topic/327237-d%C4%97l-gta-v-car-mods/?do=getNewComment
  224. prieš 54 minutes(-čių)
    https://www.supergames.lt/topic/327237-d%C4%97l-gta-v-car-mods/?do=getLastComment
  225. Investicijos
    https://www.supergames.lt/forum/488-investicijos/
  226. Ką manot apie cloud mining…
    https://www.supergames.lt/topic/327234-k%C4%85-manot-apie-cloud-mining/?do=getNewComment
  227. Forumo turgus
    https://www.supergames.lt/forum/55-forumo-turgus/
  228. Už forumo eurus
    https://www.supergames.lt/forum/466-u%C5%BE-forumo-eurus/
  229. SA:MP Skelbimai
    https://www.supergames.lt/forum/423-samp-skelbimai/
  230. CS:GO Trade (prekyba)
    https://www.supergames.lt/forum/347-csgo-trade-prekyba/
  231. Steam Turgus
    https://www.supergames.lt/forum/319-steam-turgus/
  232. Minecraft Skelbimai
    https://www.supergames.lt/forum/216-minecraft-skelbimai/
  233. MMORPG Turgus
    https://www.supergames.lt/forum/159-mmorpg-turgus/
  234. League of Legends Trade (prekyba)
    https://www.supergames.lt/forum/230-league-of-legends-trade-prekyba/
  235. Naršyklinių žaidimų Skelbimai
    https://www.supergames.lt/forum/448-nar%C5%A1yklini%C5%B3-%C5%BEaidim%C5%B3-skelbimai/
  236. Telefonų žaidimų Skelbimai
    https://www.supergames.lt/forum/435-telefon%C5%B3-%C5%BEaidim%C5%B3-skelbimai/
  237. Paskyrų Turgus
    https://www.supergames.lt/forum/465-paskyr%C5%B3-turgus/
  238. Hostingo ir serverių Skelbimai
    https://www.supergames.lt/forum/449-hostingo-ir-serveri%C5%B3-skelbimai/
  239. aukcionas
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=aukcionas
  240. dovanoju
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=dovanoju
  241. baigta
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=baigta
  242. ieškau
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=ie%C5%A1kau
  243. parduodu
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=parduodu
  244. perku
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=perku
  245. siūlau
    https://www.supergames.lt/search/?type=forums_topic&nodes=55&tags=si%C5%ABlau
  246. Parduodu lol acc euw
    https://www.supergames.lt/topic/327235-parduodu-lol-acc-euw/?do=getNewComment
  247. Steam
    https://www.supergames.lt/forum/318-steam/
  248. No text
    https://www.supergames.lt/profile/49268-forestw0w/
  249. rus/arg account
    https://www.supergames.lt/topic/326682-rusarg-account/?do=getNewComment
  250. forestw0w`
    https://www.supergames.lt/profile/49268-forestw0w/
  251. prieš 18 valandas(-ų)
    https://www.supergames.lt/topic/326682-rusarg-account/?do=getLastComment
  252. Sveikinimai ir prisistatymai
    https://www.supergames.lt/forum/51-sveikinimai-ir-prisistatymai/
  253. No text
    https://www.supergames.lt/profile/31005-lipalas/
  254. Prisistatau Martynute
    https://www.supergames.lt/topic/324577-prisistatau-martynute/?do=getNewComment
  255. Lipalas
    https://www.supergames.lt/profile/31005-lipalas/
  256. Rugpjūčio 22
    https://www.supergames.lt/topic/324577-prisistatau-martynute/?do=getLastComment
  257. Bendruomenės konkursai ir dalybos
    https://www.supergames.lt/forum/314-bendruomen%C4%97s-konkursai-ir-dalybos/
  258. No text
    https://www.supergames.lt/profile/58015-vanagasgfx/
  259. Konkursas. reikalingas log…
    https://www.supergames.lt/topic/326356-konkursas-reikalingas-logotipas-%C5%BEaidim%C5%B3-parduotuvei-prizas-30%E2%82%AC/?do=getNewComment
  260. VanagasGFX
    https://www.supergames.lt/profile/58015-vanagasgfx/
  261. Liepos 29
    https://www.supergames.lt/topic/326356-konkursas-reikalingas-logotipas-%C5%BEaidim%C5%B3-parduotuvei-prizas-30%E2%82%AC/?do=getLastComment
  262. Įdomios nuorodos, reklama
    https://www.supergames.lt/forum/57-%C4%AFdomios-nuorodos-reklama/
  263. YouTube ir Twitch kanalai
    https://www.supergames.lt/forum/429-youtube-ir-twitch-kanalai/
  264. Kvietimai registruotis ir konkursai
    https://www.supergames.lt/forum/463-kvietimai-registruotis-ir-konkursai/
  265. No text
    https://www.supergames.lt/profile/43199-n30t3x/
  266. Naujas twitch kanalas
    https://www.supergames.lt/topic/324719-naujas-twitch-kanalas/?do=getNewComment
  267. n30t3x
    https://www.supergames.lt/profile/43199-n30t3x/
  268. prieš 19 valandas(-ų)
    https://www.supergames.lt/topic/324719-naujas-twitch-kanalas/?do=getLastComment
  269. GFX
    https://www.supergames.lt/forum/71-gfx/
  270. Grafikos dizainerių anketos
    https://www.supergames.lt/forum/431-grafikos-dizaineri%C5%B3-anketos/
  271. GFX Resursai
    https://www.supergames.lt/forum/291-gfx-resursai/
  272. GFX Pamokos
    https://www.supergames.lt/forum/72-gfx-pamokos/
  273. GFX Pagalba
    https://www.supergames.lt/forum/73-gfx-pagalba/
  274. GFX Kovos-turnyrai
    https://www.supergames.lt/forum/74-gfx-kovos-turnyrai/
  275. GFX Galerija
    https://www.supergames.lt/forum/76-gfx-galerija/
  276. GFX Parduotuvė
    https://www.supergames.lt/forum/75-gfx-parduotuv%C4%97/
  277. No text
    https://www.supergames.lt/profile/56443-kentas/
  278. Vanagas GFX paslaugos
    https://www.supergames.lt/topic/321960-vanagas-gfx-paslaugos/?do=getNewComment
  279. #Kentas#
    https://www.supergames.lt/profile/56443-kentas/
  280. Vakar 12:21
    https://www.supergames.lt/topic/321960-vanagas-gfx-paslaugos/?do=getLastComment
  281. VFX
    https://www.supergames.lt/forum/285-vfx/
  282. VFX Pamokos
    https://www.supergames.lt/forum/286-vfx-pamokos/
  283. VFX Pagalba
    https://www.supergames.lt/forum/287-vfx-pagalba/
  284. VFX Kovos-turnyrai
    https://www.supergames.lt/forum/288-vfx-kovos-turnyrai/
  285. VFX Galerija/Archyvas
    https://www.supergames.lt/forum/289-vfx-galerijaarchyvas/
  286. VFX Parduotuvė
    https://www.supergames.lt/forum/290-vfx-parduotuv%C4%97/
  287. No text
    https://www.supergames.lt/profile/59046-unq/
  288. Ieškau žmogaus video monta…
    https://www.supergames.lt/topic/326354-ie%C5%A1kau-%C5%BEmogaus-video-montavimuiredagavimui/?do=getNewComment
  289. Un$q
    https://www.supergames.lt/profile/59046-unq/
  290. Liepos 28
    https://www.supergames.lt/topic/326354-ie%C5%A1kau-%C5%BEmogaus-video-montavimuiredagavimui/?do=getLastComment
  291. Tinklapių kūrimas
    https://www.supergames.lt/forum/203-tinklapi%C5%B3-k%C5%ABrimas/
  292. Turinio valdymo sistemos
    https://www.supergames.lt/forum/425-turinio-valdymo-sistemos/
  293. HTML / HTML5
    https://www.supergames.lt/forum/251-html-html5/
  294. Projektų failai
    https://www.supergames.lt/forum/256-projekt%C5%B3-failai/
  295. No text
    https://www.supergames.lt/profile/56135-malishka/
  296. Reikia IPS forumo dizaino …
    https://www.supergames.lt/topic/327193-reikia-ips-forumo-dizaino-nereikalingo/?do=getNewComment
  297. malishka
    https://www.supergames.lt/profile/56135-malishka/
  298. prieš 19 valandas(-ų)
    https://www.supergames.lt/topic/327193-reikia-ips-forumo-dizaino-nereikalingo/?do=getLastComment
  299. Programavimas
    https://www.supergames.lt/forum/298-programavimas/
  300. C++
    https://www.supergames.lt/forum/299-c/
  301. Java
    https://www.supergames.lt/forum/300-java/
  302. PHP
    https://www.supergames.lt/forum/315-php/
  303. Ieškau kas sukurtu WAP gam…
    https://www.supergames.lt/topic/327076-ie%C5%A1kau-kas-sukurtu-wap-game-bot%C4%85/?do=getNewComment
  304. Rugsėjo 5
    https://www.supergames.lt/topic/327076-ie%C5%A1kau-kas-sukurtu-wap-game-bot%C4%85/?do=getLastComment
  305. SuperGames.lt
    https://www.supergames.lt/forum/3-supergameslt/
  306. Forumo taisyklės
    https://www.supergames.lt/forum/70-forumo-taisykl%C4%97s/
  307. Naujienos ir informacija
    https://www.supergames.lt/forum/4-naujienos-ir-informacija/
  308. Apklausos
    https://www.supergames.lt/forum/461-apklausos/
  309. Naujienos ir informacija
    https://www.supergames.lt/forum/471-naujienos-ir-informacija/
  310. Archyvas
    https://www.supergames.lt/forum/472-archyvas/
  311. No text
    https://www.supergames.lt/profile/42754-all-fast-no-furious/
  312. Prašome atsinaujinti one.l…
    https://www.supergames.lt/topic/325329-pra%C5%A1ome-atsinaujinti-onelt-emailus/?do=getNewComment
  313. all fast no furious
    https://www.supergames.lt/profile/42754-all-fast-no-furious/
  314. Gegužės 24
    https://www.supergames.lt/topic/325329-pra%C5%A1ome-atsinaujinti-onelt-emailus/?do=getLastComment
  315. Klausimai ir pasiūlymai
    https://www.supergames.lt/forum/5-klausimai-ir-pasi%C5%ABlymai/
  316. Valorant kategorija
    https://www.supergames.lt/topic/327108-valorant-kategorija/?do=getNewComment
  317. Antradienis, 15:41
    https://www.supergames.lt/topic/327108-valorant-kategorija/?do=getLastComment
  318. (Pilnas sąrašas)
    https://www.supergames.lt/online/
  319. furiiK`
    https://www.supergames.lt/profile/45935-furiik/
  320. VaidasM.
    https://www.supergames.lt/profile/41288-vaidasm/
  321. heicmeister
    https://www.supergames.lt/profile/44306-heicmeister/
  322. PreFix
    https://www.supergames.lt/profile/13544-prefix/
  323. GameJob
    https://www.supergames.lt/profile/58936-gamejob/
  324. kranas
    https://www.supergames.lt/profile/42653-kranas/
  325. Matas S.
    https://www.supergames.lt/profile/10184-matas-s/
  326. QupLas
    https://www.supergames.lt/profile/32261-quplas/
  327. In*Victus |
    https://www.supergames.lt/profile/53071-invictus/
  328. Mindaugas A.
    https://www.supergames.lt/profile/40838-mindaugas-a/
  329. Zero Two
    https://www.supergames.lt/profile/12415-zero-two/
  330. Derick
    https://www.supergames.lt/profile/50212-derick/
  331. #Rokas
    https://www.supergames.lt/profile/54779-rokas/
  332. emzter
    https://www.supergames.lt/profile/60208-emzter/
  333. justed5
    https://www.supergames.lt/profile/60216-justed5/
  334. Kosmos
    https://www.supergames.lt/profile/47609-kosmos/
  335. aPacer
    https://www.supergames.lt/profile/46153-apacer/
  336. `Tomuks
    https://www.supergames.lt/profile/45011-tomuks/
  337. Septynetas.
    https://www.supergames.lt/profile/57605-septynetas/
  338. Funkis
    https://www.supergames.lt/profile/15700-funkis/
  339. NojelisXD
    https://www.supergames.lt/profile/60156-nojelisxd/
  340. Savitarna
    https://www.supergames.lt/profile/540-savitarna/
  341. prefis
    https://www.supergames.lt/profile/15502-prefis/
  342. Dovydas//
    https://www.supergames.lt/profile/45146-dovydas/
  343. Petralasu
    https://www.supergames.lt/profile/51635-petralasu/
  344. SCmindė
    https://www.supergames.lt/profile/9321-scmind%C4%97/
  345. Ethno
    https://www.supergames.lt/profile/42917-ethno/
  346. am not rookie ;p
    https://www.supergames.lt/profile/47888-am-not-rookie-p/
  347. [KuZe]
    https://www.supergames.lt/profile/58508-kuze/
  348. Mantucha
    https://www.supergames.lt/profile/44055-mantucha/
  349. acc supirkimas
    https://www.supergames.lt/profile/46629-acc-supirkimas/
  350. abbys12
    https://www.supergames.lt/profile/58051-abbys12/
  351. Svečias
    https://www.supergames.lt/profile/0-Svečias/
  352. Prisijungti
    http://supergames.lt//www.supergames.lt/login/
  353. Grand Mu online SEASON 8 Soon
    https://www.supergames.lt/topic/327162-grand-mu-online-season-8-soon/?do=findComment&comment=2270540
  354. Parašė prieš 16 minutes(-čių)
    https://www.supergames.lt/topic/327162-grand-mu-online-season-8-soon/?do=findComment&comment=2270540
  355. Dėl GTA V car mods
    https://www.supergames.lt/topic/327237-d%C4%97l-gta-v-car-mods/?do=findComment&comment=2270539
  356. Parašė prieš 53 minutes(-čių)
    https://www.supergames.lt/topic/327237-d%C4%97l-gta-v-car-mods/?do=findComment&comment=2270539
  357. Problema su discordu
    https://www.supergames.lt/topic/327200-problema-su-discordu/?do=findComment&comment=2270538
  358. Parašė prieš 1 valandą
    https://www.supergames.lt/topic/327200-problema-su-discordu/?do=findComment&comment=2270538
  359. No text
    https://www.supergames.lt/profile/43898-tautedorus/
  360. Ieskau programuotoju is plunges
    https://www.supergames.lt/topic/327143-ieskau-programuotoju-is-plunges/?do=findComment&comment=2270537
  361. Tautedorus
    https://www.supergames.lt/profile/43898-tautedorus/
  362. Parašė prieš 1 valandą
    https://www.supergames.lt/topic/327143-ieskau-programuotoju-is-plunges/?do=findComment&comment=2270537
  363. No text
    https://www.supergames.lt/profile/12415-zero-two/
  364. Problema su discordu
    https://www.supergames.lt/topic/327200-problema-su-discordu/?do=findComment&comment=2270536
  365. Parašė prieš 1 valandą
    https://www.supergames.lt/topic/327200-problema-su-discordu/?do=findComment&comment=2270536
  366. No text
    https://www.supergames.lt/profile/46629-acc-supirkimas/
  367. prieš 5 valandas(-ų)
    https://www.supergames.lt/profile/46629-acc-supirkimas/?status=174099&type=status
  368. 0 atsakymai
    https://www.supergames.lt/profile/46629-acc-supirkimas/?status=174099&type=status
  369. No text
    https://www.supergames.lt/profile/32274-pritrenktas/
  370. Ketvirtadienis, 13:02
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  371. pritrenktas
    https://www.supergames.lt/profile/32274-pritrenktas/
  372. 8 atsakymai
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  373. Rodyti ankstesnius atsakymus  3 daugiau
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status&page=2&statusWidget=1
  374. Vakar 13:51
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  375. prieš 20 valandas(-ų)
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  376. prieš 16 valandas(-ų)
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  377. @Tautedorus
    https://www.supergames.lt/profile/43898-tautedorus/
  378. prieš 1 valandą
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  379. Peržiūrėti visus atsakymus
    https://www.supergames.lt/profile/32274-pritrenktas/?status=174098&type=status
  380. No text
    https://www.supergames.lt/profile/59327-kulevafjal/
  381. Ketvirtadienis, 11:53
    https://www.supergames.lt/profile/59327-kulevafjal/?status=174097&type=status
  382. Kulevafjal
    https://www.supergames.lt/profile/59327-kulevafjal/
  383. 0 atsakymai
    https://www.supergames.lt/profile/59327-kulevafjal/?status=174097&type=status
  384. No text
    https://www.supergames.lt/profile/17075-juodagalvis/
  385. Ketvirtadienis, 10:36
    https://www.supergames.lt/profile/17075-juodagalvis/?status=174096&type=status
  386. Juodagalvis
    https://www.supergames.lt/profile/17075-juodagalvis/
  387. 2 atsakymai
    https://www.supergames.lt/profile/17075-juodagalvis/?status=174096&type=status
  388. Ketvirtadienis, 15:24
    https://www.supergames.lt/profile/17075-juodagalvis/?status=174096&type=status
  389. No text
    https://www.supergames.lt/profile/43845-linassvc/
  390. prieš 15 valandas(-ų)
    https://www.supergames.lt/profile/17075-juodagalvis/?status=174096&type=status
  391. linassvc
    https://www.supergames.lt/profile/43845-linassvc/
  392. No text
    https://www.supergames.lt/profile/48158-matce/
  393. Trečiadienis, 21:38
    https://www.supergames.lt/profile/48158-matce/?status=174095&type=status
  394. Matce
    https://www.supergames.lt/profile/48158-matce/
  395. 3 atsakymai
    https://www.supergames.lt/profile/48158-matce/?status=174095&type=status
  396. No text
    https://www.supergames.lt/profile/45777-adomas-j/
  397. Trečiadienis, 21:46
    https://www.supergames.lt/profile/48158-matce/?status=174095&type=status
  398. Adomas J.
    https://www.supergames.lt/profile/45777-adomas-j/
  399. Trečiadienis, 21:47
    https://www.supergames.lt/profile/48158-matce/?status=174095&type=status
  400. No text
    https://www.supergames.lt/profile/60020-member_id/
  401. Ketvirtadienis, 10:12
    https://www.supergames.lt/profile/48158-matce/?status=174095&type=status
  402. {member_id}
    https://www.supergames.lt/profile/60020-member_id/
  403. No text
    https://www.supergames.lt/profile/25080-justux204/
  404. Trečiadienis, 21:04
    https://www.supergames.lt/profile/25080-justux204/?status=174094&type=status
  405. Justux204
    https://www.supergames.lt/profile/25080-justux204/
  406. 1 atsakymas
    https://www.supergames.lt/profile/25080-justux204/?status=174094&type=status
  407. Ketvirtadienis, 02:31
    https://www.supergames.lt/profile/25080-justux204/?status=174094&type=status
  408. Trečiadienis, 17:09
    https://www.supergames.lt/profile/59626-saab/?status=174093&type=status
  409. 3 atsakymai
    https://www.supergames.lt/profile/59626-saab/?status=174093&type=status
  410. Trečiadienis, 18:33
    https://www.supergames.lt/profile/59626-saab/?status=174093&type=status
  411. Ketvirtadienis, 03:17
    https://www.supergames.lt/profile/59626-saab/?status=174093&type=status
  412. Ketvirtadienis, 15:05
    https://www.supergames.lt/profile/59626-saab/?status=174093&type=status
  413. No text
    https://www.supergames.lt/profile/46359-blumer/
  414. Trečiadienis, 10:39
    https://www.supergames.lt/profile/46359-blumer/?status=174092&type=status
  415. Blumer
    https://www.supergames.lt/profile/46359-blumer/
  416. 0 atsakymai
    https://www.supergames.lt/profile/46359-blumer/?status=174092&type=status
  417. Antradienis, 21:32
    https://www.supergames.lt/profile/59626-saab/?status=174091&type=status
  418. 0 atsakymai
    https://www.supergames.lt/profile/59626-saab/?status=174091&type=status
  419. No text
    https://www.supergames.lt/profile/56815-mantas008/
  420. Antradienis, 21:01
    https://www.supergames.lt/profile/56815-mantas008/?status=174090&type=status
  421. Mantas008
    https://www.supergames.lt/profile/56815-mantas008/
  422. 0 atsakymai
    https://www.supergames.lt/profile/56815-mantas008/?status=174090&type=status
  423. No text
    https://www.supergames.lt/profile/60167-dragonslt/
  424. Antradienis, 20:55
    https://www.supergames.lt/profile/60167-dragonslt/?status=174089&type=status
  425. Dragons.LT
    https://www.supergames.lt/profile/60167-dragonslt/
  426. 0 atsakymai
    https://www.supergames.lt/profile/60167-dragonslt/?status=174089&type=status
  427. No text
    https://www.supergames.lt/profile/51581-razerx/
  428. Antradienis, 17:52
    https://www.supergames.lt/profile/51581-razerx/?status=174088&type=status
  429. razerX
    https://www.supergames.lt/profile/51581-razerx/
  430. 0 atsakymai
    https://www.supergames.lt/profile/51581-razerx/?status=174088&type=status
  431. Mėnesio
    https://www.supergames.lt/index.php?app=core&module=system&controller=ajax&do=topContributors&time=month&limit=5&orientation=vertical
  432. Metų
    https://www.supergames.lt/index.php?app=core&module=system&controller=ajax&do=topContributors&time=year&limit=5&orientation=vertical
  433. Visų laikų
    https://www.supergames.lt/index.php?app=core&module=system&controller=ajax&do=topContributors&time=all&limit=5&orientation=vertical
  434. No text
    https://www.supergames.lt/profile/54925-yankee/
  435. No text
    https://www.supergames.lt/profile/45894-ministras-misteris/
  436. Ministras misteris
    https://www.supergames.lt/profile/45894-ministras-misteris/
  437. No text
    https://www.supergames.lt/profile/58064-v4psva/
  438. Rodyti daugiau
    https://www.supergames.lt/leaderboard/?time=week
  439. No text
    https://www.supergames.lt/profile/60217-saviy/
  440. saviy
    https://www.supergames.lt/profile/60217-saviy/
  441. Žaidimų naujienos
    https://www.supergames.lt/news/
  442. reklama
    https://www.supergames.lt/docs/reklama.html
  443. Robertas™
    https://www.supergames.lt/profile/24406-robertas%E2%84%A2/
  444. R'NAVI3RA
    https://www.supergames.lt/profile/43351-rnavi3ra/
  445. pscyho atsarginis
    https://www.supergames.lt/profile/47797-pscyho-atsarginis/
  446. Z u f i n a s
    https://www.supergames.lt/profile/45947-z-u-f-i-n-a-s/
  447. Vaite
    https://www.supergames.lt/profile/32498-vaite/
  448. Apache
    https://www.supergames.lt/profile/47498-apache/
  449. d3spot
    https://www.supergames.lt/profile/41516-d3spot/
  450. Vaida1337
    https://www.supergames.lt/profile/43281-vaida1337/
  451. Roba'Ggg
    https://www.supergames.lt/profile/43287-robaggg/
  452. Carl_Deli
    https://www.supergames.lt/profile/41578-carl_deli/
  453. Ciuvakas
    https://www.supergames.lt/profile/32524-ciuvakas/
  454. kfgaiming
    https://www.supergames.lt/profile/32540-kfgaiming/
  455. Espro
    https://www.supergames.lt/profile/16239-espro/
  456. zygis
    https://www.supergames.lt/profile/1489-zygis/
  457. info[eta]supergames.lt
    http://supergames.lt/cdn-cgi/l/email-protection#4a23242c250a393f3a2f382d2b272f3964263e
  458. SuperGames team'as
    https://www.supergames.lt/staff/
  459. Reklamavimosi būdai ir įkainiai
    https://www.supergames.lt/docs/reklama.html
  460. Premium narystė
    https://www.supergames.lt/store/product/17-premium-naryst%C4%97/
  461. Forumo eurai
    https://www.supergames.lt/membersshop/
  462. Geriausiai įvertinti nariai
    https://www.supergames.lt/pastleaders/?sortdirection=desc
  463. Bendruomenės kalendorius
    https://www.supergames.lt/calendar/
  464. No text
    https://www.supergames.lt/discord/invite/general/
  465. Privatumo politika
    https://www.supergames.lt/privacy/
  466. Turite paskyrą? Prisijunkite
    https://www.supergames.lt/login/

Links - Internal (nofollow)

0:

Links - Outbound

16:
  1. SuperGames programėlė
    https://play.google.com/store/apps/details?id=lt.supergames
  2. No text
    https://www.eneba.com/lt/store/games
  3. Arctic MX-4
    https://www.1a.lt/p/termo-pasta-arctic-mx-4-2019-edition-thermal-compound-2g/381t
  4. Cooler Master MasterGel Maker
    https://www.1a.lt/p/cooler-master-mastergel-maker/782i
  5. Thermal Grizzly Conductonaut
    https://www.1a.lt/p/thermal-grizzly-thermal-grease-conductonaut-1-g/2o2f
  6. https://prnt.sc/uedhzw
    https://prnt.sc/uedhzw
  7. Žaidimų parduotuvė
    https://www.eneba.com/
  8. Valiutos skaičiuoklė
    https://www.skaiciuokles.com/valiutos/
  9. No text
    https://play.google.com/store/apps/details?id=lt.supergames
  10. FS19 mods
    http://www.farmingsimulator19mods.com/
  11. Farming Simulator 2019 mods
    http://www.fsmods17.com/category/farming-simulator-2019-mods/
  12. Farming Simulator 19 mods
    https://farmingsimulator19mods.fr/
  13. Mods Farming Simulator 19
    http://www.modsfs19.com/
  14. FS 19 mods
    https://www.modls19.com/
  15. Counter strike 1.6 download
    https://www.csdownload.lt
  16. No text
    https://www.facebook.com/SuperGames.lt/

Links - Outbound (nofollow)

4:
  1. Arctic MX-4
    https://www.1a.lt/p/termo-pasta-arctic-mx-4-2019-edition-thermal-compound-2g/381t
  2. Cooler Master MasterGel Maker
    https://www.1a.lt/p/cooler-master-mastergel-maker/782i
  3. Thermal Grizzly Conductonaut
    https://www.1a.lt/p/thermal-grizzly-thermal-grease-conductonaut-1-g/2o2f
  4. https://prnt.sc/uedhzw
    https://prnt.sc/uedhzw

Keyword Cloud for Supergames.lt

sasyncnaujienos ir informacijavar s documentcreateelementscripttiksu discordu parabeidl gta8xparentnodeinsertbeforesjeipraneimai iekaukasperirospraneimaigta velse windowaddeventlistenerload asyncloadperreikiawindowattacheventonload asyncload elseparduotuvprie 20para prievalandaidimtreiadienisdiskusijos apieivron12kompiuteriovar xmiddot paradiscordu6lieposs documentcreateelementscript stypegfxreklama1 valandcounterstrikeprie 2 valandastruenaujxparentnodeinsertbefores x iffunction asyncloadantradienisifkonsolescartextjavascript sasync trueprie 167problema su discordunintendosampfunction asyncload varjustas55 prie 2mods farmingrugsjox ifgaldocumentcreateelementscript stypetemosantfalsev car modsrustsuforumo taisyklsvalandas2 valandasuatsakym nrassrcsporto4 nbspwindowattacheventnaujienos irwindowattacheventonload0 atsakymaipaskyrturgussasync true3viskas apieprisijungtiv carpagalbavisotextjavascript sasyncmodskjustas55iekotiwindowaddeventlistenerload asyncload falsewindowaddeventlistenerload asyncloadsimulatorregistruotisatsakymai atsakym nrasu discordukalendoriusaccdiscordu paraasyncload elseminutesiparduoduprie 1mandlonlinedocentasrouteh prie 2idir informacijafunction function asyncloadbendruomensnaujienoseuwasyncload varasyncload else windowaddeventlistenerloadwindowattachevent windowattacheventonloadx if windowattacheventwindowaddeventlistenerloadkonkursaikaipproblemarouteharif windowattacheventtadasaabkonsols diskusijos apiewindowattachevent windowattacheventonload asyncload5sukurtimods farming simulatornracar modsforumasmiddotirkurisiekau1nbspjmiddot para prieketvirtadienisatsakymaiatsakym nra antradienistaisyklsdiscordinformacijaasyncload var sgtaproblema suyra0klausimaielses documentcreateelementscriptpara prie 1forumefunction functionbuvoforumosupergamesltasyncloadtautedoruspmdabarriccixparentnodeinsertbefores x10if windowattachevent windowattacheventonloadatsakymai atsakym4920 valandasvkonsols diskusijosprie 20 valandasjavanuorodosmogauskurie0 atsakymviskasnra antradienisrugpjionariskelbimaiapieviskjustas55 prierugsjo 5xstype textjavascript sasyncasyncload falsetextjavascriptpritrenktasprie 1 valandfarmingtrue ssrc0 atsakymai atsakymapie viskvfxdaugiauparasasync true ssrcvakarwindowattacheventonload asyncloadbsenoskompiuteriaivar ssupergamesrouteh priekonsolsatsiliepimaisdl gta vvalandas forumeatsakymdocumentcreateelementscript stype textjavascriptelse windowaddeventlistenerloadtaikompiuteridocumentcreateelementscriptnariaiaidimaifarming simulator2kompiuterius11gta v carvarsteamfunctionstype textjavascriptdominiquediskusijosstypeprie 2prietelefonpamokos

Longtail Keyword Density for Supergames.lt

KeywordsOccurences
prie 1 valand9
prie 2 valandas-8
atsakymai atsakym nra7
0 atsakymai atsakym7
middot para prie5
para prie 15
atsakym nra antradienis4
problema su discordu4
function function asyncload3
routeh prie 23
justas55 prie 23
su discordu para3
prie 20 valandas-3
gta v car3
konsols diskusijos apie3
naujienos ir informacija3
v car mods3
dl gta v3
function asyncload var3
sasync true ssrc3
asyncload var s3
var s documentcreateelementscript3
s documentcreateelementscript stype3
documentcreateelementscript stype textjavascript3
stype textjavascript sasync3
textjavascript sasync true3
xparentnodeinsertbefores x if3
windowaddeventlistenerload asyncload false3
x if windowattachevent3
if windowattachevent windowattacheventonload3
windowattachevent windowattacheventonload asyncload3
windowattacheventonload asyncload else3
asyncload else windowaddeventlistenerload3
else windowaddeventlistenerload asyncload3
mods farming simulator3
1 valand9
prie 19
prie 28
2 valandas-8
para prie8
0 atsakymai7
viskas apie7
atsakymai atsakym7
atsakym nra7
diskusijos apie6
gta v5
valandas- forume5
middot para5
praneimai iekau5
problema su4
su discordu4
nra antradienis4
farming simulator4
prie 164
forumo taisykls4
4 nbsp4
car mods4
justas55 prie3
function function3
prie 203
20 valandas-3
discordu para3
konsols diskusijos3
naujienos ir3
ir informacija3
rugsjo 53
routeh prie3
function asyncload3
xparentnodeinsertbefores x3
asyncload var3
var s3
s documentcreateelementscript3
documentcreateelementscript stype3
stype textjavascript3
textjavascript sasync3
sasync true3
true ssrc3
var x3
x if3
0 atsakym3
if windowattachevent3
windowattachevent windowattacheventonload3
windowattacheventonload asyncload3
asyncload else3
else windowaddeventlistenerload3
windowaddeventlistenerload asyncload3
asyncload false3
dl gta3
v car3
apie visk3
mods farming3
para51
ir45
praneimai42
prie41
aidimai30
valandas-22
apie21
019
117
su13
atsakym13
aidim12
forumo12
atsakymai11
211
ketvirtadienis11
naujienos10
nra10
mods9
asyncload9
viskas9
valand9
gfx9
forume8
nbsp8
38
iekau8
tik8
daugiau8
47
s7
57
vfx7
treiadienis7
rugpjio7
gta7
67
77
supergames6
nariai6
function6
prisijungti6
diskusijos6
86
periros6
nari6
rugsjo6
var6
x6
minutes-i6
j6
middot5
simulator5
k5
problema5
temos5
pagalba5
ricci5
antradienis5
skelbimai5
u5
reikia5
false5
ar5
supergameslt5
v5
tada5
forumas5
informacija5
nuorodos4
konsols4
turgus4
kompiuteri4
94
bendruomens4
steam4
man4
104
farming4
kas4
paskyr4
dominique4
car4
discord4
registruotis4
kurie4
jei4
ant4
klausimai4
dl4
taisykls4
rust4
acc4
discordu4
justas554
saab4
parduodu4
routeh4
pritrenktas3
vakar3
reklama3
viso3
parduotuv3
nintendo3
konsoles3
pamokos3
pm3
bsenos3
mogaus3
liepos3
tautedorus3
konkursai3
gal3
ivron3
nauj3
kompiuterius3
true3
windowaddeventlistenerload3
else3
windowattacheventonload3
windowattachevent3
if3
xparentnodeinsertbefores3
ssrc3
sasync3
113
textjavascript3
stype3
documentcreateelementscript3
kalendorius3
atsiliepimai3
buvo3
iekoti3
online3
visk3
kompiuteriai3
per3
bei3
kaip3
yra3
sporto3
java3
telefon3
dabar3
docentas3
euw3
kuris3
tai3
samp3
counter-strike3
sukurti3
kompiuterio3
123
id3

Supergames.lt Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Supergames.lt is a scam?

Websites with Similar Names

Super--user.com
single phase
Super-1.com
Super-1 (100% Free Soccer & Basketball Betting Tips)
Super-12.com
Experimental Aircraft Metal Fabrication Inc.
Super-4.info
Super 4 | PLAYMOBIL
Super-4x4.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Super-6.co.kr
빈티지 쇼핑몰 슈퍼식스 supersix
Super-7restaurant.com
Maintainance Mode

Recently Updated Websites

Tehseenspcb.com 3 seconds ago.Whatizee.blogspot.mk 3 seconds ago.Buyssebeton.be 3 seconds ago.Planetobstacle.com 4 seconds ago.Kraken.com 5 seconds ago.Foqamail.com 8 seconds ago.Romagnaoggi.com 8 seconds ago.Gbhln.com 8 seconds ago.Skasonbaptiste.com 9 seconds ago.Slowwarsaw.pl 11 seconds ago.Desiign.de 11 seconds ago.Nakatar.com 12 seconds ago.Private-dns.net 13 seconds ago.Healthyturkey.com 13 seconds ago.Soccernexus.com 13 seconds ago.Campusrealestate.com 13 seconds ago.Ultieng.com 14 seconds ago.Viewtrades.com 15 seconds ago.Tmyo.org 15 seconds ago.Tapability.org 16 seconds ago.Tabanime.com 17 seconds ago.Greyhanrahan.com 18 seconds ago.Polmarkindonesia.com 19 seconds ago.Thaiecommerce.org 19 seconds ago.Ceciliaodman.se 21 seconds ago.Al-faisaly.com 22 seconds ago.Incredea.com 23 seconds ago.Soletradernation.com 23 seconds ago.Lakehousemusicacademy.com 23 seconds ago.Ferdosi.com 23 seconds ago.