Survival Kit / Umeå - Index Page

Safety: Low trust score
Year Founded: 2013
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Intenational Art Festival and workshop in Umeå and Västerbotten during 2013 and 2014



Domain summary

Last updated
2020-10-15
Domain label
survivalkitfestival
Domain extension
se
Domain registered:
2013-01-09
Domain updated:
2020-10-15
Domain expires:
2021-01-09
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is survivalkitfestival.se ranked relative to other sites:

Percentage of visits to survivalkitfestival.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Survivalkitfestival.se registered?
A: Survivalkitfestival.se was registered 8 years, 3 months, 1 week, 2 days, 17 hours, 34 minutes, 9 seconds ago on Wednesday, January 9, 2013.
Q: When was the WHOIS for Survivalkitfestival.se last updated?
A: The WHOIS entry was last updated 6 months, 3 days, 17 hours, 34 minutes, 9 seconds ago on Thursday, October 15, 2020.
Q: What are Survivalkitfestival.se's nameservers?
A: DNS for Survivalkitfestival.se is provided by the following nameservers:
  • ns4.inleed.net
  • ns3.inleed.net
  • ns2.inleed.net
  • ns1.inleed.net
Q: Who is the registrar for the Survivalkitfestival.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Survivalkitfestival.se?
A: Survivalkitfestival.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Survivalkitfestival.se each day?
A: Survivalkitfestival.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Survivalkitfestival.se resolve to?
A: Survivalkitfestival.se resolves to the IPv4 address 5.150.195.196.
Q: In what country are Survivalkitfestival.se servers located in?
A: Survivalkitfestival.se has servers located in the Sweden.
Q: What webserver software does Survivalkitfestival.se use?
A: Survivalkitfestival.se is powered by Nginx webserver.
Q: Who hosts Survivalkitfestival.se?
A: Survivalkitfestival.se is hosted by Bahnhof Internet AB in Stockholm, Saltsjoe-boo, Sweden, 132 02.
Q: How much is Survivalkitfestival.se worth?
A: Survivalkitfestival.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Survivalkitfestival.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Survivalkitfestival.se Free SEO Report

Website Inpage Analysis for Survivalkitfestival.se

H1 Headings

1 :
  1. Find us elsewhere

H2 Headings

8 :
  1. Överlevnad
  2. Nyheter & Program / Tid & Rum
  3. Medverkande konstnärer
  4. Andra Gäster - Musiker, Föreläsare, etc
  5. Om oss
  6. Organisatörer
  7. Samarbetspartners
  8. Finansiärer

H3 Headings

3 :
  1. Vad
  2. Var
  3. Om konsten

H4 Headings

45 :
  1. Time & Space
  2. Uppdateringar
  3. Program - Ulla Thogersen
  4. Program - Matti Sumari
  5. Program - Lisa Busby
  6. Filmprogram fredag 10 okt
  7. Filmprogram lördag 11 okt
  8. Filmprogram söndag 12 okt
  9. Program
  10. Nyheter
  11. Ohya Rica, Japan
  12. Gunilla Bandolin, Sverige
  13. Basir Mahmood, Pakistan
  14. Sisters of Jam - Moa & Mikaela Krestesen, Sverige
  15. Kristoffer Palmgren, Sverige
  16. Anthony Clair Wagner, Österrike
  17. Antti Laitinen, Finland
  18. Isabelle Fremeaux (Birkbeck), John Jordan & Kypros Kyprianou, Frankrike, England
  19. Mark Salvatus, Filippinerna
  20. Ulla Thøgersen, Sverige
  21. Matti Sumari, Finland
  22. Ignacio García Sánchez, Spanien
  23. Kaspars Lielgalvis, Lettland
  24. Swetlana Heger-Davis, Tjeckien/Österrike
  25. Gustav Hillbom & Erik Viklund, Sverige
  26. Erik Sjödin, Sverige
  27. Siri Hermansen, Norge
  28. SUPERFLEX, Danmark
  29. My Villages, Tyskland, England, Nederländerna
  30. Emma-Lina Ericson, Sverige
  31. Joost Conijn, Nederländerna
  32. Chto Delat, Ryssland
  33. Agnieszka Kozlowska, Polen
  34. Lisa Busby, England
  35. Zanele Muholi, Sydafrika
  36. Erik Mikael Gudrunsson, Sverige
  37. Magdalena Dziurlikowska, Sverige
  38. John Söderberg, Sverige
  39. Akram Al Halabi, Österrike / Golanhöjderna
  40. Atsuko Otsuka, Japan
  41. Hannah Anbert, Danmark
  42. Projektledare
  43. Festivalkontor
  44. Festivalens öppettider
  45. Info om Maskinen Art Boat - Umeå-Wasaline-Vasa

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

67 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Survivalkitfestival.se

av denverkfrelsningar ochgustavegenhakonstenunder festivalenalltev engelskakonstnrerursep klsurvival kitstephenoch verkarkonstfrstalivetdessklbdaverbiomusikerltskrivare ume sverigeeftertvlrdag 11emmalina ericsonfinlandcurrentsamarbeteandrablirmellanfilmrummedansinhllssamarbetethidethumbsvenmobilparkkl 1100konstverk7englandokt 12001500 vnortsparken10maskinenvrtdensep kl 1100p engelskademengelskaatt manfredaglassemonajournalistchto delatgod tidbaravrldenmoveverlevnaduniversitetfr attbergfrskerfrgormnniskaerik sjdinvisasheltlokalamenu4vill11fseminariervarsenasteume universitetlasse bergfestivalenmahmoodframlovehadelisa busbymittfunctiontillsammansume2014verklighetensfysisktfr survival kitstt attderrickplanet kungsgatan 1011evmycketoch frfattarengotgramybdeflerathumbsfbelementgustav hillbomwagnermoderatorfrmstsedangenomp svenskanatursistersskerhank1010samtaloch harsvl somtillgitarrkit umeannanarbeteplatsergalleri maskinenarbetar medmoberggjortkonstnrvissatysklandbokcafericsonmanbm psamtfrelsningarblmat ochvrasurvival kit umevnortsparkenvs somnyheterverkarv p svenskavillep svenska engelskaviaplatsumesv perikalltidngraderrick jensenfolketsfrgor om31012kungsgatangsterfotografiskamerbehandlarprojektgallerikitjuliap svenska evsomfrfattarevadnannategnadrfrnskapautforskarvisastorasumarisakerobjektvita kubenjaghurpilgatanboatoktpplanethar varitjensensigmusikermnniska och naturmedmngamnniska ochintekungsgatan 101universityutvaritvi ville19 oktsisters of jamtrailerfotografisjlvsittdivkubenleverdetomokt 14001700vidart boatburchmotblevoktobernrsina13sa moberggreatborse12001500grjamfilmenume ochsjlvalandskaphennesbcmigv scencaf planet kungsgatanbildmuseetrwandateckningume sverigeprogramjournalist ochrvrkulturellasvenska engelskasvenskanaturenbusbytidigarebland annatnorrlandsoperanarbetarsjdinsamhlletskringhanscafsvlmen20 septembervisarfrminafolkets bioframfrmstemusikerltskrivarepilgatan 16installationernuatt alltengelska seminariumsngtrailer galleryflexhallenimagegenom attfrstoch pseminariumbokcaf pilgatanperformance12001500 vnortsparkenharizverklighetendjkommakungsgatan 92d14001700utgrkan vijustgrnserscensverige6emmalinasvenska ev engelskafilmprogramglobalkommerkalahariofta2som rmnniskansvitaseptembertill attdelfacebookossmusikerltskrivare umefr survivalhillbomsepnewnraolikaunderskerettbm5maskinen artp etthar8sttersarecaf planetmona ersareppnarutan12planet kungsgataninteraktivabrjadeattlivserokt 12001500taavochdel avvideomindrfrgalleryartdelatmed bltidkan9umemusikoch naturmaskinen art boatgreat parkmateriallrdagmadridsndagsvenska evunderlisasalccaoktober klfutureppettiderchtoarbetatsfrelsningbildocksvihongodblanddoneellerk101 pjulia harizinfoeuropaftthur kangruppensistarigasurvivalmatti sumariuppsamarbete medbliberlinmattihasmatlngre

Longtail Keyword Density for Survivalkitfestival.se

KeywordsOccurences
survival kit ume6
sep kl 11004
p svenska engelska4
v p svenska4
p svenska ev4
svenska ev engelska4
maskinen art boat3
caf planet kungsgatan3
planet kungsgatan 1013
okt 1200-1500 vnortsparken3
fr survival kit3
sisters of jam3
mnniska och natur3
musikerltskrivare ume sverige3
survival kit24
p svenska12
p engelska9
genom att7
vita kuben6
kit ume6
fr att6
v p5
folkets bio5
bland annat5
okt 1200-15005
arbetar med5
trailer gallery5
lisa busby5
pilgatan 165
mona ersare5
great park4
svenska engelska4
kl 11004
bm p4
sep kl4
ev engelska4
att man4
bokcaf pilgatan4
derrick jensen4
svenska ev4
lasse berg4
frgor om4
p ett4
20 september4
frelsningar och4
chto delat4
mnniska och4
och natur4
erik sjdin3
emma-lina ericson3
ume sverige3
musikerltskrivare ume3
till att3
julia hariz3
k101 p3
s som3
gustav hillbom3
stt att3
oktober kl3
att allt3
engelska seminarium3
och frfattare3
ume universitet3
som r3
och verkar3
fr survival3
19 okt3
okt 1400-17003
v scen3
och har3
mat och3
svl som3
samarbete med3
kungsgatan 923
galleri maskinen3
under festivalen3
hur kan3
kan vi3
vi ville3
ume och3
av den3
del av3
sa moberg3
har varit3
maskinen art3
art boat3
och p3
med bl3
caf planet3
planet kungsgatan3
kungsgatan 1013
god tid3
matti sumari3
1200-1500 vnortsparken3
lrdag 113
journalist och3
och207
av85
som77
p75
r56
med56
att55
fr44
vi38
ett33
ume31
den28
det27
survival26
har26
till26
var25
kit24
jag22
om20
engelska18
under17
okt17
eller16
svenska16
sverige16
sig16
frn15
genom14
festivalen14
v14
platser13
kan13
oktober13
han12
hon11
mellan11
s11
verkligheten10
bm10
hur10
dr10
mat10
musik10
andra10
program10
olika9
k1019
pilgatan9
projekt9
kring9
arbetar9
kommer9
hans9
kl9
riga9
september9
tid8
verk8
bl8
ven8
samtal8
1200-15008
konstnrer8
samt8
arbete8
frfattare8
ur8
vad7
erik7
film7
frgor7
sedan7
menu7
man7
inte7
varit7
sin7
lrdag7
nr7
vnortsparken7
maskinen7
sep7
lisa7
sng6
vita6
gallery6
art6
men6
kungsgatan6
function6
se6
gra6
verlevnad6
06
hennes6
vrt6
16
kuben6
ocks6
n6
gr6
26
fotografi6
new6
plats6
mig6
bildmuseet6
busby5
sina5
konstnr5
ersare5
35
del5
oss5
my5
folkets5
bio5
ngot5
mona5
45
image5
fredag5
galleri5
frelsningar5
trailer5
annat5
bland5
mer5
konst5
vr5
natur5
visas5
landskap5
min5
d5
sitt5
senaste4
upp4
fb4
thumbs4
ut4
objekt4
ser4
sndag4
54
utforskar4
madrid4
love4
delat4
mnniskans4
chto4
emma-lina4
64
ofta4
musikerltskrivare4
egna4
vid4
material4
berg4
lasse4
mot4
efter4
jensen4
derrick4
liv4
hade4
universitet4
journalist4
div4
julia4
mnniska4
park4
element4
great4
ev4
current4
mnga4
utan4
filmen4
livet4
planet4
egen4
video4
arbetat4
tv4
stt4
frst4
visa4
f4
gjort4
lngre4
frmst4
performance4
fram4
bor4
sjlva4
via4
brjade4
skapa4
bokcaf4
verkar4
flexhallen4
74
scen4
nyheter4
bde4
ume20144
vra4
svl4
mitt3
blir3
europa3
fysiskt3
gster3
alltid3
england3
konstverk3
medan3
info3
fotografiska3
lcca3
tidigare3
frsker3
bli3
just3
vrlden3
kulturella3
helt3
facebook3
bara3
ftt3
allt3
burch3
interaktiva3
komma3
verklighetens3
musiker3
framfr3
gitarr3
samarbete3
bda3
move3
ppnar3
ericson3
kalahari3
bild3
83
gruppen3
93
seminarier3
ver3
finland3
berlin3
blev3
konsten3
103
samhllets3
mste3
university3
lokala3
teckning3
has3
installationer3
ta3
vissa3
grnser3
rum3
dj3
tyskland3
hariz3
undersker3
sista3
dess3
wagner3
boat3
utgr3
moberg3
sa3
113
tillsammans3
nu3
bc3
moderator3
caf3
rwanda3
123
norrlandsoperan3
future3
ngra3
mobil3
filmprogram3
nra3
10-123
1400-17003
sumari3
matti3
ppettider3
seminarium3
done3
ville3
sker3
jam3
sisters3
mycket3
umes3
mahmood3
god3
behandlar3
saker3
stora3
global3
drfr3
frsta3
mina3
naturen3
visar3
lever3
sjlv3
dem3
annan3
hillbom3
gustav3
samarbetet3
frelsning3
stephen3
133
flera3
sjdin3
ha3
hlls3
vill3
hidethumbs3

Who hosts Survivalkitfestival.se?

Survivalkitfestival.se Hosting Provider Information

Hosted IP Address:5.150.195.196
Hosted Hostname:5.150.195.196
Service Provider:Bahnhof Internet AB
Hosted Country:SwedenSE
Location Latitude:59.3173
Location Longitude:18.255
Webserver Software:nginx

Is "Bahnhof Internet AB" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Bahnhof Internet AB
0.0093%

HTTP Header Analysis for Survivalkitfestival.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 15 Oct 2020 21:40:21 GMT
Content-Type: text/html
Last-Modified: Tue, 10 Mar 2015 08:33:36 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
ETag: W/"54feac60-18954"
Content-Encoding: gzip

Survivalkitfestival.se Domain Nameserver Information

HostIP AddressCountry
ns4.inleed.net 194.68.59.6
ns3.inleed.net 5.150.195.197
ns2.inleed.net 5.150.195.195
ns1.inleed.net 5.150.195.194


Need to find out who hosts Survivalkitfestival.se?


Domain Registration (WhoIs) information for Survivalkitfestival.se

 # Copyright (c) 1997- IIS (The Internet Foundation In Sweden).
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: survivalkitfestival.se
holder: alever5180-00001
admin-c: -
tech-c: -
billing-c: -
created: 2013-01-09
modified: 2016-12-06
expires: 2018-01-09
transferred: 2015-09-28
nserver: ns4.inleed.net
nserver: ns3.inleed.net
nserver: ns2.inleed.net
nserver: ns1.inleed.net
dnssec: unsigned delegation
status: ok
registrar: INLEED

Websites with Similar Names

Survi.in
Survi Reviews -
Survi.xyz
survi.xyz | 523: Origin is unreachable
Survia3d.com
EXO HOSTING - webhosting, domény
Survialblueprint1.com
Stansberry Research
Survialblueprint2.com
Stansberry Research

Recently Updated Websites

539046.com (1 second ago.)Solarmovies.ru (2 seconds ago.)Junctionmagazine.com (2 seconds ago.)Tafflab.org (3 seconds ago.)Studygravity.com (3 seconds ago.)Airspacecs.com (3 seconds ago.)Cmjedits.com (3 seconds ago.)Zumbaenzeta.com (3 seconds ago.)Tritaniequine.com (3 seconds ago.)Thegrowingpains.com (3 seconds ago.)Purcellmarianhighschool.com (3 seconds ago.)Athenaknowledge.info (3 seconds ago.)Polgenpro.org (3 seconds ago.)Dylanrumrell.com (3 seconds ago.)Filix.us (3 seconds ago.)Polynesiantransformation.com (4 seconds ago.)Paradeszo.com (4 seconds ago.)X-integrated.org (4 seconds ago.)Nederlandsehoertjes.nl (4 seconds ago.)Chaolicheye.com (4 seconds ago.)Elalambrador.com (5 seconds ago.)Adbsrv.com (5 seconds ago.)Rfafa.com (5 seconds ago.)Hinchablesparacomuniones.com (5 seconds ago.)Jaquelfaucet.com (5 seconds ago.)420nappin.com (5 seconds ago.)Webdesigndistrict.com (5 seconds ago.)Cannadianbrands.com (5 seconds ago.)Balkanfestival.org (5 seconds ago.)Asiarents.com (5 seconds ago.)

Recently Searched Keywords

【重要转载】安徽省学校新冠肺炎师生员工个人防护手册 (3 seconds ago.)ar 400 (6 seconds ago.)listings sitemap (7 seconds ago.)germ (8 seconds ago.)fullslide hd (11 seconds ago.)angel air force one (12 seconds ago.)pirelli (14 seconds ago.)north st (14 seconds ago.)shoemart (15 seconds ago.)daraz online shoping (16 seconds ago.)background-color rgb251 246 (18 seconds ago.)訂單查詢 (23 seconds ago.)‌মৌলভীবাজার থে‌কে নি‌খোঁজ দুই যুবক ভার‌তে গণ‌পিটু‌নি‌তে নিহত! (24 seconds ago.)duffy and friends (24 seconds ago.)ce numro (25 seconds ago.)griditem--4 background-image (25 seconds ago.)3301946m91 (27 seconds ago.)footer-widget (27 seconds ago.)yacht masters course (29 seconds ago.)bärlauch-bitter-kur (30 seconds ago.)rotherham (31 seconds ago.)x 2300 (32 seconds ago.)điện thoại di động (33 seconds ago.)californiavotingcom (35 seconds ago.)icf foam (36 seconds ago.)very fair (38 seconds ago.)how is it working (38 seconds ago.)else videoisplayingvideogallery3false (39 seconds ago.)may 15, 2020may 15, 2020 (39 seconds ago.)32 vs 23 (39 seconds ago.)