Sushito.bg

Website Thumbnail
Checking...
Sushi Restaurant | Sushito.bg | България

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-16
Category: This site has not been categorized yet

Вземи суши сет на най добра цена и невероятно качество. Само сега суши сет "Биг Бенто" на цена от 55 лв. вместо 79 лв. 2 кг. 79 хапки.


Domain summary

Domain label
sushito
Domain extension
bg
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is sushito.bg ranked relative to other sites:

Percentage of visits to sushito.bg from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sushito.bg registered?
A: Sushito.bg was registered 1 month, 2 weeks, 3 days, 2 hours, 25 minutes, 5 seconds ago on Friday, October 16, 2020.
Q: When was the WHOIS for Sushito.bg last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 3 days, 2 hours, 25 minutes, 5 seconds ago on Friday, October 16, 2020.
Q: What are Sushito.bg's nameservers?
A: DNS for Sushito.bg is provided by the following nameservers:
  • ns3.wixdns.net
  • ns2.wixdns.net
Q: Who is the registrar for the Sushito.bg domain?
A: The domain has been registered at .
Q: What is the traffic rank for Sushito.bg?
A: Sushito.bg has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Sushito.bg each day?
A: Sushito.bg receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Sushito.bg resolve to?
A: Sushito.bg resolves to the IPv4 address 23.236.62.147.
Q: In what country are Sushito.bg servers located in?
A: Sushito.bg has servers located in the United States.
Q: What webserver software does Sushito.bg use?
A: Sushito.bg is powered by webserver.
Q: Who hosts Sushito.bg?
A: Sushito.bg is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Sushito.bg worth?
A: Sushito.bg has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Sushito.bg Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sushito.bg Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sushito.bg

H1 Headings

1 :
  1. A TASTE OF JAPAN

H2 Headings

0 :

H3 Headings

3 :
  1. морско дъно
  2. I'm a title
  3. 26

H4 Headings

0 :

H5 Headings

3 :
  1. контакти
  2. За нас
  3. Резервирай маса

H6 Headings

0 :

Total IFRAMEs

4 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sushito.bg

metakeywordsseopagetitleseosushi restaurant sushitobgcolor2a2a2aultxtnew olselecthovertypemetapropsnamedescriptioncontent 55 7905s easecolorfont normalbackgroundcolor ffffffstylejq6rnq4enavcontainerimpactimpactw012010impactw022010impactw102010sansserifpositionfixed importantleftautocolor373737fontfamilyhelveticargba255sushitobg pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushisushitobg typemetapropsnamedescriptioncontentimportantleftauto importantzindex50if249 249 1backgroundcolorrgba255varpositionfixed7249 1backgroundcolorrgba255fontfamilyhelveticawidth100height100backgroundrgba255 255 255sushitobgnormal normal 17px14em255 1 stylejq6rnq4enavcontainer255 255 09fontsize0margintop5pxborderwidth2px borderstylesolidbordercolorrgba249 249pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi restaurant204 204stylej2sr70tlautoplay spanease 0simportantleftauto980px 0555 79stylej2sr70tlautoplaystylejq6rnq4enavcontainerleftdirectionmarginleftsolid rgba255fontnormal normalcolor 000000oleditmarginleft calc100width100height100nbspcalc100 980px 05border0stylejq6rnq4enavcontainercenterdirectioncolor373737fontfamilyhelvetica neuergba0 0normal 14px14em55 79 2restaurantstylej2rbnrjwlabelwrapperhelvetica arialspaneasehc3bgselectfocuswidth100height100backgroundrgba255normal normal normaltransitionopacityhelveticaneuew0255roma helveticaneuew1055roma helveticanormal 14px14em openiframewebkitfullscreen minheightauto importantrgba0calc100typemetapropsnamedescriptioncontent 55descriptionoldirrtlpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushinormal normal 14px14emstylej2sr70tlimageitempanel79 metakeywordsseopagetitleseosushineue helveticaneuew0155roma helveticaneuew0255romaopenarial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenter255 09fontsize0margintop5pxstylejq6rnq4enavcontainerarrowstylejq6rnq4enavcontainercenterdirectionpositionfixed importantleftauto importantzindex50borderstylesolidbordercolorrgba249 249selectdatapreviewerrordescription clickmargin0lineheightnormalletterspacingnormal txtnewsanssansserif colorffffff249 1backgroundcolorrgba255 255open sanssansserif colorffffffstylej2sr70tlbuttons opacity1helvetica arial sansserifdisplaynonemargin0lineheightnormalletterspacingnormalhelveticaneuew1055romabackgroundcolorrestaurant sushitobg pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi17px14em openimpactimpactw012010impactw022010impactw102010sansserif colorfffffffontfamilyhelvetica neue helveticaneuew0155romastylejq6rnq4enavcontainerarrowstylej2sr70tlimageitempanel opacity02helveticaneuew1055roma helvetica arial255 255stylejq6rnq4erepeaterbuttonlabelstylej2sr70tlbuttonsol ulsolid rgba255 255fontnormal normal normalneue helveticaneuew0155roma53050pxfffffffontfamilyhelvetica neuestylej2rbnrjwlinkstylej2sr70tlpnl opacity1overflowhiddenopacity1rgba255 255displaynonestylej2sr70tlbtnclick2 79 metakeywordsseopagetitleseosushi17px14em open sanssansserifpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi restaurant sushitobg04shelveticaneuew0255roma helveticaneuew1055romastylej2sr70tldatastatetouchrollovermetakeywordsseopagetitleseosushi restaurant79 metakeywordsseopagetitleseosushi restaurant17px14emsansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenter6neuehelveticaneuew0155roma helveticaneuew0255romatransitionopacity 05shelveticaneuew0155romaborderstylesolidbordercolorrgba249rgba255 255 2552 79helveticaneuew0255romaiframe positionabsolutewidth100height100overflowhiddenpositionabsolutewidth100height100overflowhiddenarial14px14em openselectdataerrortrueselectdatapreviewfocusstylejq6rnq4enavcontainerarrow stylejq6rnq4enavcontainersvgcontaineriframewebkitfullscreen minheightauto05sul249 249selectdatapreviewhoveropen sanssansserif0 042 42helveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romafont normal normalstylejq6rnq4enavcontainerarrowstylejq6rnq4enavcontainerleftdirectionimportantzindex50color0099fftextdecorationunderlinecursorpointer1pxiframewebkitfullscreenpositionabsolutetop0right0bottom0left0positionabsolutetop0left0color373737width100height100stylejq6rnq4enavcontainerrightdirection1backgroundcolorrgba255 25504s ease 0srestaurant sushitobgmarginleft calc100 980px980px10pxstylejq6rnq4erepeaterbuttondatastatedropopacity1 stylej2sr70tlhover79 2 79fontnormalborderstylesolidbordercolorrgba249 249 249255 1typemetapropsnamedescriptioncontent05s ease 0sdisplayinlineblockminheightauto importantarial sansserifdisplaynone1backgroundcolorrgba255 255 255stylejq6rnq4enavcontainersvgcontainersushitobg pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi restaurantnormal 17px14em opencolorffffff14px14em open sanssansserif4fc3bgultxtnew255 255 1fontstylej2sr70tlhelperstransitionopacity 05s ease18sansserifdisplaynonehelveticaneuew1055roma helvetica14px14emclick to editcolor373737fontfamilyhelvetica neue helveticaneuew0155romasushitobg typemetapropsnamedescriptioncontent 55borderwidth2pxstylej2sr70tlpnlimpactimpactw012010impactw022010impactw102010sansserif color2a2a2anormal normalwidth100height100backgroundrgba255 255solidhelveticacolor ffffffborderwidth2px borderstylesolidbordercolorrgba24979 2iframenormalhelvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterstylej2rbnrjwlabelminheightautotxtnew0calc100 980pxbackgroundcolor 000000rgba0 0 01 stylejq6rnq4enavcontainersanssansserifrestaurant sushitobg typemetapropsnamedescriptioncontentopacity01backgroundcolorrgba255borderradius009fontsize0margintop5pximportantstylej2sr70tlhoverselectdatapreviewerror stylejq6rnq4enavcontainerarrow000000opacity1 stylej2sr70tldatastatetouchrollover0stopautobottom0normal 17px14emstylejq6rnq4enavcontainerarrowstylejq6rnq4enavcontainerrightdirectionmetakeywordsseopagetitleseosushitxtnew ul04s ease

Longtail Keyword Density for Sushito.bg

KeywordsOccurences
margin-left calc100 980px17
calc100 980px 0517
font normal normal11
normal normal normal11
255 255 19
helveticaneuew10-55roma helvetica arial8
open sanssans-serif colorffffff8
55 79 28
neue helveticaneuew01-55roma helveticaneuew02-55roma8
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma8
helveticaneuew02-55roma helveticaneuew10-55roma helvetica8
79 2 798
04s ease 0s6
rgba255 255 2556
fontnormal normal normal6
normal normal 14px14em5
normal 14px14em open5
14px14em open sanssans-serif5
restaurant sushitobg typemetapropsnamedescriptioncontent4
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
helvetica arial sans-serifdisplaynone4
color373737font-familyhelvetica neue helveticaneuew01-55roma4
sushitobg typemetapropsnamedescriptioncontent 554
click to edit4
font-familyhelvetica neue helveticaneuew01-55roma4
iframe-webkit-full-screen min-heightauto important4
255 255 09font-size0margin-top5px4
249 1background-colorrgba255 2554
rgba0 0 04
width100height100backgroundrgba255 255 2554
border-stylesolidborder-colorrgba249 249 2494
249 249 1background-colorrgba2554
border-width2px border-stylesolidborder-colorrgba249 2494
1background-colorrgba255 255 2554
255 1 style-jq6rnq4enavcontainer4
solid rgba255 2554
05s ease 0s4
typemetapropsnamedescriptioncontent 55 794
positionfixed importantleftauto importantz-index503
transitionopacity 05s ease3
17px14em open sanssans-serif3
2 79 metakeywordsseopagetitleseosushi3
79 metakeywordsseopagetitleseosushi restaurant3
metakeywordsseopagetitleseosushi restaurant sushitobg3
restaurant sushitobg pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi3
sushitobg pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi restaurant3
pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi restaurant sushitobg3
normal 17px14em open3
normal normal 17px14em3
normal normal30
980px 0517
margin-left calc10017
255 25517
calc100 980px17
open sanssans-serif13
font normal11
0 010
ease 0s10
255 19
helveticaneuew02-55roma helveticaneuew10-55roma8
55 798
helveticaneuew01-55roma helveticaneuew02-55roma8
helvetica arial8
neue helveticaneuew01-55roma8
sanssans-serif colorffffff8
79 28
2 798
restaurant sushitobg8
helveticaneuew10-55roma helvetica8
margin0line-heightnormalletter-spacingnormal txtnew7
42 427
04s ease6
fontnormal normal6
rgba255 2556
1 style-jq6rnq4enavcontainer5
204 2045
14px14em open5
normal 14px14em5
width100height100backgroundrgba255 2554
iframe positionabsolutewidth100height100overflowhidden4
iframe-webkit-full-screen min-heightauto4
sushitobg typemetapropsnamedescriptioncontent4
min-heightauto important4
txtnew ul4
255 09font-size0margin-top5px4
color373737font-familyhelvetica neue4
font-familyhelvetica neue4
description click4
arial sans-serifdisplaynone4
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
typemetapropsnamedescriptioncontent 554
249 2494
solid rgba2554
border-width2px border-stylesolidborder-colorrgba2494
border-stylesolidborder-colorrgba249 2494
opacity1 style-j2sr70tldata-statetouchrollover4
249 1background-colorrgba2554
1background-colorrgba255 2554
rgba0 04
style-j2sr70tlbuttons opacity14
05s ease4
metakeywordsseopagetitleseosushi restaurant3
79 metakeywordsseopagetitleseosushi3
background-color 0000003
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif colorffffff3
color 0000003
normal 17px14em3
sushitobg pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi3
pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi restaurant3
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif color2a2a2a3
17px14em open3
style-j2sr70tlimageitempanel opacity03
color ffffff3
background-color ffffff3
style-jq6rnq4enavcontainerarrow style-jq6rnq4enavcontainersvgcontainer3
selectdata-previewerror style-jq6rnq4enavcontainerarrow3
positionfixed importantleftauto3
importantleftauto importantz-index503
transitionopacity 05s3
opacity1 style-j2sr70tlhover3
style-j2sr70tlpnl opacity13
ol ul3
ultxtnew ol3
style-j2sr70tlautoplay span3
normal49
background-color37
color36
034
128
0520
txtnew18
margin-left17
calc10017
980px17
opacity117
216
important14
314
414
open13
style-jq6rnq4enavcontainer13
sanssans-serif13
positionabsolutetop0right0bottom0left012
colorffffff12
displaynone11
style-jq6rnq4enavcontainerarrow11
solid11
font11
sushitobg10
ease10
0s10
ul10
510
arial8
helvetica8
helveticaneuew10-55roma8
positionabsolutetop0left0color373737width100height1008
restaurant8
68
helveticaneuew02-55roma8
helveticaneuew01-55roma8
78
neue8
88
margin0line-heightnormalletter-spacingnormal7
var7
ol7
style-jq6rnq4enavcontainerarrowstyle-jq6rnq4enavcontainerright-direction6
style-jq6rnq4enavcontainerarrowstyle-jq6rnq4enavcontainerleft-direction6
style-jq6rnq4enavcontainerarrowstyle-jq6rnq4enavcontainercenter-direction6
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif6
rgba2556
fontnormal6
04s6
style-j2sr70tlimageitempanel6
ffffff6
0000006
style-j2sr70tlbuttons5
if5
ultxtnew5
overflowhidden5
14px14em5
border05
style-j2sr70tlautoplay5
iframe4
positionabsolutewidth100height100overflowhidden4
iframe-webkit-full-screen4
min-heightauto4
color373737font-familyhelvetica4
edit4
width100height1004
width100height100backgroundrgba2554
09font-size0margin-top5px4
displayinline-block4
click4
description4
style-j2rbnrjwlabel4
style-j2rbnrjwlink4
sans-serifdisplaynone4
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
font-familyhelvetica4
color0099fftext-decorationunderlinecursorpointer4
style-j2rbnrjwlabelwrapper4
typemetapropsnamedescriptioncontent4
border-width2px4
border-radius04
color2a2a2a4
opacity04
style-j2sr70tldata-statetouchrollover4
style-j2sr70tlhelpers4
05s4
rgba04
style-jq6rnq4erepeaterbuttonlabel4
10px4
border-stylesolidborder-colorrgba2494
1background-colorrgba2554
selecthover3
style-jq6rnq4enavcontainerleft-direction3
style-jq6rnq4enavcontainersvgcontainer3
oldirrtl3
nbsp3
selectdata-previewhover3
1px3
17px14em3
metakeywordsseopagetitleseosushi3
pageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1syzmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg1tmnmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri41d0001cf4f28171cc7edfe90c8334f1a1866cjpgwidth1280height854altcolorcolor20aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypetitlechildrensushi3
0px3
selectdata-previewerror3
selectfocus3
topautobottom03
style-j2sr70tlpnl3
style-j2sr70tlhover3
span3
transitionopacity3
style-j2sr70tlbtn3
hc3bg3
importantz-index503
selectdata-previewfocus3
importantleftauto3
positionfixed3
style-jq6rnq4erepeaterbuttondata-statedrop3
style-jq6rnq4enavcontainercenter-direction3
style-jq6rnq4enavcontainerright-direction3
selectdata-errortrue3
fc3bg3

Who hosts Sushito.bg?

Sushito.bg Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Sushito.bg

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Fri, 16 Oct 2020 20:49:04 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.sushito.bg/
content-language: en
X-Wix-Request-Id: 1602881344.164526957968668810205
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: jeslxIFvDH4ulYwNNi 3Muwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgAmI6NXu6WfqLI/M7f8tcV,2d58ifebGbosy5xc FRalmVzvUjPAMVStcBQTqfF PfzVg3CbuVAyaPNcfTMHSLwRM17xYjdF0Dano1Rj5 vHw==,2UNV7KOq4oGjA5 PKsX47BzxWFBtKoqbaB2M/rwsEsk=,m0j2EEknGIVUW/liY8BLLpKBwxGlovVE0fM/42WHC0w=,qJS91GsscGZlb16v 8nwmBaTzQc9HhjE jRaWyWY1DAPUN6zYCeYUhP LoeE7OiY,pglrwSJCjYpA6tXbCNiuHE2ifZ3dVu7qIfrB/mt/oGR75R lYLwLpIThFe0z7UqVjaDemqcS0HEi36hME/Bt8g==
Cache-Control: no-cache
Expires: -1

Sushito.bg Domain Nameserver Information

HostIP AddressCountry
ns3.wixdns.net 216.239.38.100
ns2.wixdns.net 216.239.36.100


Need to find out who hosts Sushito.bg?


Domain Registration (WhoIs) information for Sushito.bg

Websites with Similar Names

Sushi-10.com
Sushi Ten
Sushi-academy.com
California Sushi Academy
Sushi-aixlesmilles.com
Kyo Sushi - Aix Les Milles, Pôle d'Activités
Sushi-akira.fr
sushi-akira.fr

Recently Updated Websites

Slimekidstv.com (2 seconds ago.)Shiatsu-et-reflexologie.com (4 seconds ago.)Stonekisser.com (4 seconds ago.)Steak24hr.com (5 seconds ago.)Spunkyincstore.com (6 seconds ago.)Skysomsolutionsincltd.com (7 seconds ago.)Topveganchef.com (7 seconds ago.)Softroadingnewzealand.com (13 seconds ago.)Vapefromspace.com (13 seconds ago.)Tutorers.com (15 seconds ago.)Tnmlqk.com (18 seconds ago.)Vistafalconminer.com (20 seconds ago.)Scienceknowledgecenter.com (21 seconds ago.)Specialeofferte.com (22 seconds ago.)Utahsteamcleaning.com (24 seconds ago.)Swiftpeel.com (24 seconds ago.)Gezeitenhaus-akademie.de (26 seconds ago.)Sdhuaze.com (27 seconds ago.)Theskinnyedit.com (27 seconds ago.)Sixsixtytwomedia.com (29 seconds ago.)Sweetpeas-florals.com (30 seconds ago.)Swissspecialforceknife.com (30 seconds ago.)Ssee6.com (31 seconds ago.)Swisssafetyknives.com (32 seconds ago.)Shaoszjianqi.com (33 seconds ago.)Vsautotech.com (34 seconds ago.)Silverbiohackercoach.com (35 seconds ago.)Tswweb.com (35 seconds ago.)Schofeweb.com (35 seconds ago.)Upsitespeed.com (37 seconds ago.)

Recently Searched Keywords

style-jpk3h5zisubmenu style-jpk3h5ziitem (1 second ago.)quedado (2 seconds ago.)con compromiso y (3 seconds ago.)arun (4 seconds ago.)sự kiện (5 seconds ago.)sabrina (7 seconds ago.)s c (8 seconds ago.)goed (9 seconds ago.)sacré bleu (11 seconds ago.)prix 890 (12 seconds ago.)发表新主题 (17 seconds ago.)dar (18 seconds ago.)dystrybucja (21 seconds ago.)histo (24 seconds ago.)atheism (27 seconds ago.)clula eucariota (28 seconds ago.)mc (31 seconds ago.)quantity nbsp add (32 seconds ago.)usps fast (32 seconds ago.)initial color rgb0 (33 seconds ago.)nonefont-size (33 seconds ago.)item var row (33 seconds ago.)6d6d6d font-family (34 seconds ago.)100 text-rendering (34 seconds ago.)092121 font-family (35 seconds ago.)pozyczka do 1000 zl (35 seconds ago.)font-family work sans (35 seconds ago.)15px line-height (35 seconds ago.)partnerprogramm (36 seconds ago.)banner-slider (36 seconds ago.)