SVG OPEN

Le site SVG Open est expert dans tous les domaines de l'actualité et de l'internet francophone.


Domain summary

SafetyLow trust score
Year Founded
2020
Global Traffic Rank
577,765
Estimated Worth
$2,160
Last updated
2022-03-01
Domain label
svgopen
Domain extension
org
Domain registered:
2020-03-11
Domain updated:
2022-03-01
Statvoo Rating
H
Estimated daily income
$9
Estimated monthly income
$274

Frequently Asked Questions (FAQ)

Q: When was Svgopen.org registered?
A: Svgopen.org was registered 2 years, 3 months, 2 weeks, 1 day, 5 hours, 53 minutes, 16 seconds ago on Wednesday, March 11, 2020.
Q: When was the WHOIS for Svgopen.org last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 4 days, 5 hours, 53 minutes, 16 seconds ago on Tuesday, March 1, 2022.
Q: What are Svgopen.org's nameservers?
A: DNS for Svgopen.org is provided by the following nameservers:
  • yadiel.ns.cloudflare.com
  • nena.ns.cloudflare.com
Q: Who is the registrar for the Svgopen.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Svgopen.org?
A: Svgopen.org ranks 577,765 globally on Alexa. Svgopen.org has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Svgopen.org each day?
A: Svgopen.org receives approximately 1,523 visitors and 3,046 page impressions per day.
Q: What IP address does Svgopen.org resolve to?
A: Svgopen.org resolves to the IPv4 address 172.67.191.62.
Q: In what country are Svgopen.org servers located in?
A: Svgopen.org has servers located in the United States.
Q: What webserver software does Svgopen.org use?
A: Svgopen.org is powered by CloudFlare webserver.
Q: Who hosts Svgopen.org?
A: Svgopen.org is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Svgopen.org worth?
A: Svgopen.org has an estimated worth of $2,160. An average daily income of approximately $9, which is roughly $274 per month.

Svgopen.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Svgopen.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Svgopen.org

H1 Headings

0 :

H2 Headings

14 :
  1. Comment déboucher une baignoire soi-même
  2. Quel art divinatoire choisir pour une consultation en voyance 
  3. Quelques idées pour une pendaison de crémaillère réussie
  4. Voyance en ligne : comment éviter les arnaques 
  5. Quel est l’intérêt de procéder à une segmentation marketing ?
  6. Vins corbières : origine, production et accompagnement.
  7. Quelles sont les raisons de recourir à la voyance en ligne ?
  8. Comment réussir un déco style ethnique ?
  9. 2 critères clés pour dénicher le meilleur prestataire de service financier mobile
  10. Amour : la voyance peut-elle aider à choisir le bon conjoint ?
  11. La tiny house en France : un véritable mode de vie ?
  12. Qu’appelle-t-on couramment chapiteau de réception ?
  13. Navigation des articles
  14. Sponsors du Magazine

H3 Headings

1 :
  1. Les dernières nouvelles

H4 Headings

10 :
  1. Quel est l’intérêt de procéder à une segmentation marketing ?
  2. En France, les médecins sont conventionnés, mais quelles sont les différences entre secteurs ?
  3. Combien coûte une bague ancienne
  4. Freelances : les inconvénients et avantages de l’indépendance
  5. Comment décorer son jardin pour Halloween
  6. Les rédacteurs freelance de plus en plus plébiscités par les entreprises
  7. Comment déboucher une baignoire soi-même
  8. Quel art divinatoire choisir pour une consultation en voyance 
  9. Quelques idées pour une pendaison de crémaillère réussie
  10. Voyance en ligne : comment éviter les arnaques 

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

74:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Svgopen.org

financierrussir ununequicatgorienbsp astuces conseilsildco stylecrsquoestsvgopen catgorienbsp artcontinuercatgorienbsp astucesplus en plusetsurrussir un dcoplussvgopen catgorienbsp astucesvivrecorbiresservicelecture publitrouver2022 rdigil yvoyance en lignemobilesont6financier mobilemarketinglifestylerdigvivre lifestyleparnbsp svgopen catgorienbspjanvier29 20212lrsquointrt de procderartastuces conseilsstyleune segmentationvoyancenovembre 2021servicesunprocderstyle ethniquevie2021 rdig parnbsppublioctsvgopen catgorienbsprdig parnbsprussirlenbspfvrier 2022 rdigagraveleart de vivrevouspubli lenbspcommentchoisirdco style ethniqueservice financiernovembre 2021 rdigsegmentation marketingservice financier mobileune segmentation marketingestfvrier 2022astuceslignemagazinepour unepersonnespourcatgorienbsp artseysont lesproductionjanvier 2022 rdiglecture publi lenbsp2022 rdig parnbspprocder une segmentationcontinuer la lectureelle2021 rdigparnbsp svgopen5vinsconseilscatgorienbspun dco stylelecturenovembrelesdesun dcoparnbspcetteoct 29francemaissegmentationjanvier 20224ethniqueest lrsquointrtrdig parnbsp svgopendcochapiteausvgopen301procder unefvriersonlrsquointrtqueloct 29 2021prestataire

Longtail Keyword Density for Svgopen.org

KeywordsOccurences
rdig parnbsp svgopen10
parnbsp svgopen catgorienbsp10
2022 rdig parnbsp8
lecture publi lenbsp8
continuer la lecture8
janvier 2022 rdig5
catgorienbsp astuces conseils4
2021 rdig parnbsp4
oct 29 20214
voyance en ligne4
plus en plus3
service financier mobile3
procder une segmentation3
dco style ethnique3
un dco style3
svgopen catgorienbsp astuces3
novembre 2021 rdig3
russir un dco3
fvrier 2022 rdig3
une segmentation marketing3
svgopen catgorienbsp art3
art de vivre3
lrsquointrt de procder3
rdig parnbsp12
publi lenbsp12
svgopen catgorienbsp10
parnbsp svgopen10
2022 rdig8
lecture publi8
il y6
janvier 20225
pour une4
catgorienbsp astuces4
style ethnique4
astuces conseils4
2021 rdig4
29 20214
oct 294
est lrsquointrt3
financier mobile3
un dco3
service financier3
russir un3
sont les3
segmentation marketing3
novembre 20213
une segmentation3
fvrier 20223
procder une3
catgorienbsp art3
vivre lifestyle3
dco style3
pour14
une14
parnbsp12
rdig12
lenbsp12
publi12
catgorienbsp12
les10
un10
svgopen10
010
le10
plus9
19
continuer8
voyance8
lecture8
comment7
des6
y6
est6
marketing6
il6
conseils5
25
art5
astuces5
oct5
qui5
style5
janvier5
ethnique4
ligne4
et4
segmentation4
choisir4
dco4
sont4
mobile4
quel4
production4
sur4
34
vins3
cette3
fvrier3
lifestyle3
vivre3
se3
trouver3
vous3
crsquoest3
vie3
elle3
personnes3
43
novembre3
financier3
agrave3
53
russir3
corbires3
prestataire3
service3
63
lrsquointrt3
magazine3
france3
mais3
son3
services3
procder3
chapiteau3

Who hosts Svgopen.org?

Svgopen.org Hosting Provider Information

Hosted IP Address:172.67.191.62
Hosted Hostname:172.67.191.62
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
T-Mobile USA, Inc.
1.1993%

HTTP Header Analysis for Svgopen.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 01 Mar 2022 08:00:45 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 17 Feb 2022 11:28:46 GMT
Vary: Accept-Encoding
Strict-Transport-Security: max-age=16000000
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=IR/Ro5zhB+hcop6kHqaZQy1xaIZ05NDsIyQu0h+eMjczAEn5KLwGiOHYR8mUFS2GFXqnHa1M0+zS+LzXiR0ko0cYveB2TwISmxrXcAN2mM+UPrPEcD1ukdx57TLP7aGHnaE="}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 6e505c5c9902755e-LHR
Content-Encoding: gzip
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400

Svgopen.org Domain Nameserver Information

HostIP AddressCountry
yadiel.ns.cloudflare.com 162.159.44.4
nena.ns.cloudflare.com 162.159.38.161


Need to find out who hosts Svgopen.org?


Domain Registration (WhoIs) information for Svgopen.org

 Domain Name: SVGOPEN.ORG
Registry Domain ID: D402200000015078731-LROR
Registrar WHOIS Server: whois.internet.bs
Registrar URL: www.internet.bs
Updated Date: 2022-02-08T02:56:37Z
Creation Date: 2020-11-03T14:30:44Z
Registry Expiry Date: 2023-11-03T14:30:44Z
Registrar Registration Expiration Date:
Registrar: Internet Domain Service BS Corp
Registrar IANA ID: 2487
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.5167401179
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Registrant Organization: Whois Privacy Corp.
Registrant State/Province: New Providence
Registrant Country: BS
Name Server: YADIEL.NS.CLOUDFLARE.COM
Name Server: NENA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2022-03-01T07:59:46Z

Websites with Similar Names

Svgop.com
Home - Santa Clara County Republican Party
Svgopen.com
403 Forbidden
Svgopen.org
SVG OPEN
Svgoptimiser.com
SVG Optimizer – Optimize SVG Images Online

Recently Updated Websites

Aqeeq.net (3 seconds ago.)Chilloutsports.com (6 seconds ago.)Mbp.ac (11 seconds ago.)Womensprosoccer.com (11 seconds ago.)Gestaoescolar.org.br (12 seconds ago.)Auctionplugin.net (12 seconds ago.)Conectafiction.com (14 seconds ago.)Batshare.com (15 seconds ago.)Hogslat.com (17 seconds ago.)Themattmosphere.com (17 seconds ago.)Small-world-treasure-chest.work (22 seconds ago.)Cartagenafood.com (25 seconds ago.)Developer.mulesoft.com (26 seconds ago.)Merrillpharmacy.com (26 seconds ago.)Koloto.bandcamp.com (27 seconds ago.)Cleanhealthyaz.com (29 seconds ago.)Herohomeadvisor.com (31 seconds ago.)Nonflyingnomad.com (34 seconds ago.)Equatorialgroup.com (35 seconds ago.)Theslickfloors.com (37 seconds ago.)Emir.bg (39 seconds ago.)Versecbd.com (40 seconds ago.)Ritzwv.com (40 seconds ago.)Mazur.nrw (44 seconds ago.)Advalio-ma.com (44 seconds ago.)Baerumkulturhus.no (44 seconds ago.)Nasenpflegeoel.de (48 seconds ago.)Fieldstowndental.com (49 seconds ago.)Super-professional.com (50 seconds ago.)Hellobluephoto.com (51 seconds ago.)

Recently Searched Keywords

3 range 1 (1 second ago.)style-jnu9ep8rmenucontainer (1 second ago.)noble-ads (1 second ago.)skelters (1 second ago.)accéderà la frise (2 seconds ago.)нашиконтакты (2 seconds ago.)moche (3 seconds ago.)style-jvjiziumlanguagebutton (3 seconds ago.)first lesson (4 seconds ago.)vēl attēli (4 seconds ago.)dslc-module-2149 (4 seconds ago.)package holidays to maldives from dubai (4 seconds ago.)most frequent (5 seconds ago.)ff-custom-color color (5 seconds ago.)dropdown nav dropdown-menu (5 seconds ago.)andes meaning (6 seconds ago.)mbc55 (6 seconds ago.)21st october 2020 (6 seconds ago.)seopro (6 seconds ago.)мы в instagram (7 seconds ago.)mağazacılık ve perakendecilik (7 seconds ago.)turn-page (8 seconds ago.)---- 1 vip (8 seconds ago.)için (8 seconds ago.)european union (euro)1999 - 2020 (9 seconds ago.)forged bypass (9 seconds ago.)affiliated with merrill (9 seconds ago.)ph httpswwwyoutubecomchanneluc36ku81osss3n25pe-o6y7g welcome (10 seconds ago.)tuik (10 seconds ago.)stream meditations (10 seconds ago.)