Domain summary

Last updated
2021-05-13
Domain label
swis-shop
Domain extension
cz
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Swis-shop.cz registered?
A: Swis-shop.cz was registered 4 months, 1 week, 5 days, 21 hours, 31 minutes, 19 seconds ago on Thursday, May 13, 2021.
Q: When was the WHOIS for Swis-shop.cz last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 5 days, 21 hours, 31 minutes, 19 seconds ago on Thursday, May 13, 2021.
Q: What are Swis-shop.cz's nameservers?
A: DNS for Swis-shop.cz is provided by the following nameservers:
  • ns.forpsi.net
  • ns.forpsi.it
  • ns.forpsi.cz
Q: Who is the registrar for the Swis-shop.cz domain?
A: The domain has been registered at CZ-NIC.
Q: What is the traffic rank for Swis-shop.cz?
A: Swis-shop.cz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Swis-shop.cz each day?
A: Swis-shop.cz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Swis-shop.cz resolve to?
A: Swis-shop.cz resolves to the IPv4 address 217.16.177.8.
Q: In what country are Swis-shop.cz servers located in?
A: Swis-shop.cz has servers located in the Czech Republic.
Q: What webserver software does Swis-shop.cz use?
A: Swis-shop.cz is powered by Hi from server! webserver.
Q: Who hosts Swis-shop.cz?
A: Swis-shop.cz is hosted by VSHosting s.r.o. in Czechia.
Q: How much is Swis-shop.cz worth?
A: Swis-shop.cz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Swis-shop.cz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Swis-shop.cz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Swis-shop.cz

H1 Headings

2 :
  1. VANS
  2. Swis-Shop CZ

H2 Headings

11 :
  1. Nová kolekce Billabong
  2. Nová kolekce Horsefeathers
  3. Oblíbená kolekce Vans
  4. Největší výběr bot
  5. Skate boty, městské boty, snowboardové boty a nebo taky pantofle- máme vše skladem po celý rok!
  6. Největší výběr SK8 hardwaru
  7. Velký výběr doplňků
  8. Novinky
  9. Naše výhody
  10. Značky
  11. SWIS-SHOP.CZ

H3 Headings

22 :
  1. Etnies Scout BLACK/WHITE/GUM
  2. Etnies Scout Plus black
  3. Etnies Marana NAVY/TAN
  4. Billabong D BAH PRO black
  5. Oakley Fuel Cell Pol Blk w/ PRIZM Grey
  6. Oakley Gibston Pol Rootbeer w/ PRIZM Bronze
  7. Element Brand
  8. Nový Billabong
  9. Horsefeathers přichází
  10. Batohy pro všechny
  11. Nové boty!
  12. Bike Shop
  13. Naše prodejna v Ústí nad Labem
  14. RVCA - čti ruka
  15. Nejlepší skateshop
  16. Jarní bundy
  17. Oakley Holbrook Matte Black w/+ Red Iridium
  18. Horsefeathers INGRID azteca
  19. RVCA TANGIER PAISLEY MULTI
  20. Star 8 - 20psi
  21. Nixon KENSINGTON LEATHER SADDLESAGE
  22. Nixon TANGENT MATTEBLACKSURPLUS

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

82 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

722:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Swis-shop.cz

k 1obleeniacute zimniacute obleeniacutezimnkloboukypltnbotydmskkalhotykraasy kraasydnovponokykotnkovslunentrikatrikatakhodinkydigitln hodinkycestovniacute tascaronkyelementtakyledvinkypenenkypenaacutely a boxykolnzahnutmscaronaacutetkymikinymikiny nazvoltebatohypnskobleeniacutezimnzapnnmikinycoscaronaacutelysimmeznaekhodinkydigitlnrukvemkoile sna zapnnmikiny peskscaroniltovkykiltovky sepicezimn epiceberanices rovnmrukvemtrika sslyaskobleeniacute zimniacutejevanskufry cestovniacutekolekceepicezimnobleeniacutejarnepiceberanicedlouhmhodinkycestovniacute tascaronkyponokyfunkn ponokyopaskyblack1420 736760 921s rovnm kiltemkiltovkysluneniacute bryacutelesportovn slunenvekterkrtkm rukvemtrikajakoboxykolnsluneniacuteopaskykoen opaskysynteticktascaronky a kufrysportovnbryacutele sluneniacutesvetrysvetry na zapnnsvetryzapnnsvetry pesukalhotyzimn kalhotykraasy kraasydnovtascaronky a kufryhlavubundyopaskykoenopaskysyntetickobleeniacutebotystreet420 736 760krtkm rukvemkoileeod5na zapnnmikinykrtkmstreet obleeniacutejarnrukaviceprstovletniacutezimniacute obleeniacutezimn bundyzimntakyskatekrtkm rukvemtrika s736 760koscaronilekoile szimniacutebillabong jerukvemtrikanebos krtkm rukvemtrikas krtkmobleeniacutezimn bundyzimnopaskytextiln opaskykoenkraasypltn kraasyteplkovrukvemkoile s dlouhmsnowboardovzbokufrynejleppenaacutelyrovnm kiltemkiltovkytunely scaronaacutetkyobleeniacute street obleeniacutejarnhorsefeathersponokyklasick ponokykotnkovboxy penaacutelys dlouhmscaronaacutetky scaronaacutelyvszapnnmikiny pestentiacutelkaletnprvzimniacute obleeniacutezimnkiltemkiltovkyzanovvarzsnowboardingalebundyzimn bundyjarnkrtkm rukvemkoile sse zahnutmbrlehodinkytiacutelkaletn tlkafitnessbundyjarn bundykalhoty6brlehodinky hodinkyanalogovkraasydnovnspes hlavubundy bundyzimnopaskytextilnswisshopczkloboukyslamnk 2tunely scaronaacutetky scaronaacutelyhodinkydigitln hodinkycestovniacutemikinymikinybotydtskkalhotykraasysvtkprotakycestovntrikatrika s krtkmponokyopasky3hodinkyanalogov hodinkydigitln hodinkycestovniacutekufrysportovn takycestovnbotystreet botyzimnbotycestovniacutesvetrysvetry naobleeniacute streetbotyzimnsluneniacute bryacutelesportovnrukvemtrika s dlouhmrovnm kiltemkiltovky sezapnnsvetry0vbrlehodinky hodinkyanalogov hodinkydigitlnhodinkyanalogovkraasypltnobleeniacute letniacutehlavubundy bundyzimntunelyplavkykoupacpokudsetrikatrika srukvemkoile1koscaronilekoile s krtkmpesbundyzimn bundyjarn bundykalhotybryacutelepes hlavubundyboxybryacutelesportovnbryacutelesportovn slunennaletponokyklasick ponokykotnkov ponokyfunkncruiser2ponokykotnkov ponokyfunkn ponokyopaskykraasyteplkovdocestovniacute tascaronkykscaroniltovkykiltovky s rovnmuankypletenepiceberanice a uankypleten4billabongkloboukyslamn kloboukypltnhlavubundy bundyzimn bundyjarnponokyopasky opaskytextiln opaskykoenbundyzimntascaronkykscaroniltovkykiltovkyponokyfunkn ponokyopasky opaskytextilnvechkoscaronilekoilepenenkybotyskatesvetrysvetrybryacutele sluneniacute bryacutelesportovns krtkm rukvemkoilekiltemkiltovky semikinymikiny na zapnnmikinyrukavicepalcov rukaviceprstovkufry cestovniacute tascaronkykiltemkiltovky se zahnutmbundykalhotyponokyopasky opaskytextilnbundyjarnna zapnnsvetrypaacutenskeacuteznakykalhotyzimn kalhotykraasyponokyfunknhodinkycestovniacutekalhotyzimnquiksilverhodinkyanalogov hodinkydigitlndctlkafitnesssprvnkalhotykraasy kraasydnov kraasypltnna zapnnsvetry pesjsoustreetrukavicepalcovorovnmkraasydnov kraasypltn kraasyteplkovponokyklasickopaskytextiln opaskykoen opaskysyntetick736 760 921scaronaacutely a tunelykufrysportovnkraasydnov kraasypltnvbrbatohyponokykotnkov ponokyfunkn

Longtail Keyword Density for Swis-shop.cz

KeywordsOccurences
420 736 7603
rovnm kiltemkiltovky se3
ponokyklasick ponokykotnkov ponokyfunkn3
ponokykotnkov ponokyfunkn ponokyopasky3
ponokyfunkn ponokyopasky opaskytextiln3
ponokyopasky opaskytextiln opaskykoen3
opaskytextiln opaskykoen opaskysyntetick3
epiceberanice a uankypleten3
kscaroniltovkykiltovky s rovnm3
s rovnm kiltemkiltovky3
kiltemkiltovky se zahnutm3
scaronaacutely a tunely3
bryacutele sluneniacute bryacutelesportovn3
sluneniacute bryacutelesportovn slunen3
brlehodinky hodinkyanalogov hodinkydigitln3
hodinkyanalogov hodinkydigitln hodinkycestovniacute3
hodinkydigitln hodinkycestovniacute tascaronky3
tascaronky a kufry3
kufry cestovniacute tascaronky3
tascaronky a kufrysportovn3
tunely scaronaacutetky scaronaacutely3
rukvemtrika s dlouhm3
736 760 9213
na zapnnsvetry pes3
koscaronilekoile s krtkm3
s krtkm rukvemkoile3
krtkm rukvemkoile s3
rukvemkoile s dlouhm3
obleeniacute street obleeniacutejarn3
obleeniacute zimniacute obleeniacutezimn3
zimniacute obleeniacutezimn bundyzimn3
svetrysvetry na zapnnsvetry3
mikinymikiny na zapnnmikiny3
krtkm rukvemtrika s3
na zapnnmikiny pes3
pes hlavubundy bundyzimn3
hlavubundy bundyzimn bundyjarn3
bundyzimn bundyjarn bundykalhoty3
kalhotyzimn kalhotykraasy kraasydnov3
kalhotykraasy kraasydnov kraasypltn3
kraasydnov kraasypltn kraasyteplkov3
trikatrika s krtkm3
s krtkm rukvemtrika3
penaacutely a boxykoln3
s krtkm7
s dlouhm6
botystreet botyzimn5
bryacutele sluneniacute4
opaskytextiln opaskykoen3
kscaroniltovkykiltovky s3
epicezimn epiceberanice3
opaskykoen opaskysyntetick3
420 7363
ponokyopasky opaskytextiln3
rovnm kiltemkiltovky3
ponokyfunkn ponokyopasky3
ponokykotnkov ponokyfunkn3
ponokyklasick ponokykotnkov3
rukavicepalcov rukaviceprstov3
scaronaacutetky scaronaacutely3
s rovnm3
se zahnutm3
kiltemkiltovky se3
kloboukyslamn kloboukypltn3
sluneniacute bryacutelesportovn3
bryacutelesportovn slunen3
brlehodinky hodinkyanalogov3
hodinkyanalogov hodinkydigitln3
hodinkydigitln hodinkycestovniacute3
hodinkycestovniacute tascaronky3
kufry cestovniacute3
cestovniacute tascaronky3
kufrysportovn takycestovn3
boxy penaacutely3
k 13
tunely scaronaacutetky3
rukvemtrika s3
tiacutelkaletn tlkafitness3
na zapnnsvetry3
760 9213
billabong je3
koscaronilekoile s3
krtkm rukvemkoile3
rukvemkoile s3
obleeniacute street3
street obleeniacutejarn3
obleeniacute letniacute3
obleeniacute zimniacute3
zimniacute obleeniacutezimn3
obleeniacutezimn bundyzimn3
svetrysvetry na3
zapnnsvetry pes3
736 7603
mikinymikiny na3
na zapnnmikiny3
zapnnmikiny pes3
pes hlavubundy3
hlavubundy bundyzimn3
bundyzimn bundyjarn3
bundyjarn bundykalhoty3
kalhotyzimn kalhotykraasy3
kalhotykraasy kraasydnov3
kraasydnov kraasypltn3
kraasypltn kraasyteplkov3
trikatrika s3
krtkm rukvemtrika3
k 23
na24
s19
k16
snowboardov13
pro13
se13
boty13
je11
tak10
tascaronky10
obleeniacute9
pes9
ve7
krtkm7
u7
vech7
do7
billabong7
nebo7
kolekce7
od7
v6
nejlep6
zvolte6
botystreet6
nov6
bundyzimn6
kter6
znaky6
slunen6
scaronaacutely6
dlouhm6
ale5
var5
skate5
horsefeathers5
vans5
z5
za5
botyzimn5
jako4
jsou4
pokud4
brlehodinky4
bryacutele4
ns4
e4
co4
vbr4
element4
si4
cruiser4
batohy4
botydmsk4
sluneniacute4
kalhotyzimn4
znaek4
mme4
takycestovn3
zbo3
swis-shopcz3
hodinkyanalogov3
hodinkydigitln3
hodinkycestovniacute3
black13
kufry3
cestovniacute3
kufrysportovn3
03
13
takyledvinkypenenky3
dc3
boxy3
penaacutely3
boxykoln3
taky3
let3
batohypnsk3
penenky3
sprvn3
o3
botydtsk3
quiksilver3
prv3
lyask3
opaskykoen3
bryacutelesportovn3
letniacute3
kalhotykraasy3
bundykalhoty3
bundyjarn3
hlavubundy3
zapnnmikiny3
mikinymikiny3
zapnnsvetry3
svetrysvetry3
obleeniacutezimn3
zimniacute3
obleeniacutejarn3
kraasypltn3
street3
rukvemkoile3
koscaronilekoile3
snowboarding3
svt3
ten3
paacutenskeacute3
23
33
43
53
kraasydnov3
kraasyteplkov3
zahnutm3
ponokyfunkn3
kiltemkiltovky3
rovnm3
kscaroniltovkykiltovky3
uankypleten3
epiceberanice3
epicezimn3
botyskate3
opaskysyntetick3
63
opaskytextiln3
ponokyopasky3
ponokykotnkov3
trikatrika3
ponokyklasick3
rukaviceprstov3
rukavicepalcov3
scaronaacutetky3
tunely3
kloboukypltn3
kloboukyslamn3
plavkykoupac3
tlkafitness3
tiacutelkaletn3
rukvemtrika3
vs3

Who hosts Swis-shop.cz?

Swis-shop.cz Hosting Provider Information

Hosted IP Address:217.16.177.8
Hosted Hostname:lipdistribution-dedik.vshosting.cz
Service Provider:VSHosting s.r.o.
Hosted Country:Czech RepublicCZ
Location Latitude:50.0853
Location Longitude:14.411
Webserver Software:Hi from server!

Is "VSHosting s.r.o." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
VSHosting s.r.o.
0.0239%

HTTP Header Analysis for Swis-shop.cz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Vary: Accept-Encoding
Server: Hi from server!
X-Powered-By: ASP.NET
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Access-Control-Allow-Origin: *
X-XSS-Protection: 1; mode=block
Referrer-Policy: no-referrer-when-downgrade
Strict-Transport-Security: max-age=15768000; includeSubDomains; preload
Content-Security-Policy: default-src * blob: 'self' data: 'unsafe-inline' 'unsafe-eval' https:;
Date: Thu, 13 May 2021 02:47:38 GMT
Content-Length: 37099

Swis-shop.cz Domain Nameserver Information

HostIP AddressCountry
ns.forpsi.net 81.2.194.130
ns.forpsi.it 95.110.254.165
ns.forpsi.cz 81.2.209.185


Need to find out who hosts Swis-shop.cz?


Domain Registration (WhoIs) information for Swis-shop.cz

 % (c) 2006-2019 CZ.NIC, z.s.p.o.
%
% Intended use of supplied data and information
%
% Data contained in the domain name register, as well as information
% supplied through public information services of CZ.NIC association,
% are appointed only for purposes connected with Internet network
% administration and operation, or for the purpose of legal or other
% similar proceedings, in process as regards a matter connected
% particularly with holding and using a concrete domain name.
%
% Full text available at:
% http://www.nic.cz/page/306/intended-use-of-supplied-data-and-information/
%
% See also a search service at http://www.nic.cz/whois/
%
%
% Whoisd Server Version: 3.12.0
% Timestamp: Sun Mar 07 23:34:07 2021

domain: swis-shop.cz
registrant: PEACE
nsset: FORPSI
keyset: FORPSI-KS-UK1JCPN5
registrar: REG-INTERNET-CZ
registered: 06.02.2003 13:46:00
changed: 19.02.2018 14:03:27
expire: 06.02.2022

contact: PEACE
org: LIP distribution s.r.o.
name: Jiří Bůbal
address: Velké náměstí 140
address: Strakonice
address: 38601
address: CZ
registrar: REG-MOJEID
created: 06.10.2011 16:03:06

nsset: FORPSI
nserver: ns.forpsi.net
nserver: ns.forpsi.cz (81.2.209.185, 2001:15e8:201:1::d1b9)
nserver: ns.forpsi.it
tech-c: FORPSI
registrar: REG-INTERNET-CZ
created: 01.10.2007 10:19:47
changed: 05.01.2016 11:50:14

contact: FORPSI
org: INTERNET CZ, a.s.
name: Stefano Cecconi
address: Ktiš 2
address: Ktiš
address: 38403
address: CZ
registrar: REG-INTERNET-CZ
created: 04.08.2008 14:42:08
changed: 15.05.2018 21:32:00

keyset: FORPSI-KS-UK1JCPN5
dnskey: 257 3 10 AwEAAaIOQCiuR/5bWnbCj8/AnCeOcdJ2l6iUXAfPSGGpzFgaSXj1vRcs+t2Zw2hOAbe0gYcnpbQi0+LXt9PSsHZ5anZQh6pV9jjp12FFCDSSm3bdDKWUMCD0TLCRxNgKpL56eoDtx+EzNaC99YVk4O2DhVxvOYPhh10NFAgzsidf0n+Q3dJv7hYBFYh21lmmi27IA6luJKJzx//G1+Komd4q9qlWpFDh5uj6wHdpghWsR0F33UEYEZ+Ofiz9dkOGtnnaGy3Xq9oRItwcdvqnS4fCjGSpWU8Us1SoZQwtT8O5DnpqTmDJFO6gYIV5CzAJqDlexJAkVVy74AtYC1aFFw9YkWs=
tech-c: FORPSI-KEYSET
registrar: REG-INTERNET-CZ
created: 06.01.2016 10:00:39
changed: 23.11.2018 01:27:07

contact: FORPSI-KEYSET
org: INTERNET CZ, a.s.
name: Stefano Cecconi
address: Ktiš 2
address: Ktiš
address: 38403
address: CZ
registrar: REG-INTERNET-CZ
created: 12.12.2011 11:16:39
changed: 11.11.2019 10:05:22

Websites with Similar Names

Swis-acs.acs.ac.th
Assumption College Sriracha
Swis-shop.cz
Swis-Shop CZ

Recently Updated Websites

Linhadecodigo.com.br (8 seconds ago.)Abigailboutique.com (12 seconds ago.)Baneh.com (23 seconds ago.)Sleepsbarbershop.com (28 seconds ago.)Goksoytextile.com (30 seconds ago.)Newsprecinctapp.com (33 seconds ago.)Eispop.com (37 seconds ago.)Pornoklaus.net (38 seconds ago.)Baserevolu.com (40 seconds ago.)Victormedina.xyz (43 seconds ago.)Kqrp.xyz (45 seconds ago.)Mcnair-photography.com (48 seconds ago.)Tanzanianjobs.com (49 seconds ago.)Syneco.be (49 seconds ago.)Willliveson.com (51 seconds ago.)Internationalsugarbaby.com (53 seconds ago.)Style360.us (54 seconds ago.)Colab.ph (54 seconds ago.)Oeufah.com (1 minute ago.)Vividconsultants.com (1 minute 4 seconds ago.)Geuldongmu.org (1 minute 5 seconds ago.)Toros.photos (1 minute 9 seconds ago.)Yambarealestate.com (1 minute 10 seconds ago.)Iqtutorial.com (1 minute 10 seconds ago.)Thevirtualcollegefair.com (1 minute 11 seconds ago.)Polyneuro.com (1 minute 12 seconds ago.)Virtualvva.com (1 minute 12 seconds ago.)Antibiotiques-sans-ordonnance.com (1 minute 12 seconds ago.)Jxj.rocks (1 minute 27 seconds ago.)Cdyihang.com (1 minute 27 seconds ago.)

Recently Searched Keywords

г¬гґг¤гёг¶гёг­г  (1 second ago.)рейтинги (1 second ago.)find job (1 second ago.)morocco saudi (9 seconds ago.)nbsp - - (13 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (14 seconds ago.)28 şubat 2018 (17 seconds ago.)tyjm (20 seconds ago.)folder: h.i.s.d (20 seconds ago.)desde los (21 seconds ago.)da mulher (23 seconds ago.)functionwdu var (26 seconds ago.)dealsbroadband (31 seconds ago.)vacances scolaires 2020 lyon (34 seconds ago.)второй раз пьяный за рулем без прав наказание (38 seconds ago.)pasangan (38 seconds ago.)智睿政务问卷调查系统 v10.9.3 (39 seconds ago.)um den (42 seconds ago.)body massage escorts (44 seconds ago.)scooli (47 seconds ago.)route 53 health check (47 seconds ago.)tdi21484 tdblockinner margin-left (48 seconds ago.)agdata-usa (49 seconds ago.)20200204 100740 (49 seconds ago.)become synonym word hippo (50 seconds ago.)dataverkeer (51 seconds ago.)chittorgarh (51 seconds ago.)gnther (52 seconds ago.)technology education (54 seconds ago.)praise the lord lyrics (55 seconds ago.)