Szentanna-to.ro  |  Szent Anna-tó
Low trust score  | 
A Szent Anna-tó Székelyföld egyik legvonzóbb természeti látványossága... A Szent Anna-tó és krátere...949-950 m tengerszint feletti magasságban van. A Mohos tőzegláp (népi nevén: Kukojzás, vagy Kukujzás-posvány) Várható éves eseménynaptár, Anna napi búcsú Szálláshelyek A Szent Anna-to legendája.

Szentanna-to.ro Website Information

Szentanna-to.ro has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 8,755,773, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Szentanna-to.ro is hosted by Best Telecom SRL in Romania.
Szentanna-to.ro has an IP Address of 89.36.160.25 and a hostname of 89.36.160.25.

The domain szentanna-to.ro was registered 201 decades 8 years 9 months ago by nic.ro, it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for szentanna-to.ro

Full Whois Lookup for Szentanna-to.ro Whois Lookup

% Whois Server Version 3.0 - whois.rotld.ro:43

% Rights restricted by copyright.
% Specifically, this data MAY ONLY be used for Internet operational
% purposes. It may not be used for targeted advertising or any
% other purpose.

% Este INTERZISA folosirea datelor de pe acest server in oricare
% alt scop decat operarea retelei. In special este INTERZISA
% folosirea lor in scopuri publicitare.

% Top Level Domain : ro
% Maintainance : www.rotld.ro

Domain Name: szentanna-to.ro
Registered On: 2011-08-29
Registrar: ROSPOT SRL
Referral URL: http://rohost.com

DNSSEC: Inactive

Nameserver: ns.t-i.ro
Nameserver: ns1.t-i.ro

Domain Status: OK

Who hosts Szentanna-to.ro?

Szentanna-to.ro Web Server Information

Hosted IP Address:89.36.160.25
Hosted Hostname:89.36.160.25
Service Provider:Best Telecom SRL
Hosted Country:RomaniaRO
Location Latitude:46
Location Longitude:25
Webserver Software:Not Applicable

HTTP Header Analysis for Szentanna-to.ro

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 20 Jan 2016 20:25:24 GMT
Server: Apache/2.2.22 (Ubuntu)
X-Powered-By: PHP/5.2.17
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 14065
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Szentanna-to.ro?

Szentanna-to.ro Free SEO Report

Website Inpage Analysis for Szentanna-to.ro

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Szentanna-to.ro

bilesus kszonfeltz turiathisattrrelindexofleavescrolledajaxnbsp nbspjson delayjpgsee the sourceelltsra 4istinyinfolive0 50000s diszntorosfvaluedateformat4 raesemnyek1 templateresultterm page paramspage1 ratpusa minden tipusbookcurrpgsusthisattrswincomment29szllshelyed programajnlatodgyere s egyligylbalvanyos blvnyosfrddisznvgs sdisznvgs s diszntorostunadroundpriceparseintscalerange1 mathexp660 6611mindenra 3 ratorjakszonfeltzlzreti plieiibile tunad tusndfrdra 5josnoudefprice1defpricecra 4 ranbsp800 2000nbsp klyhamzeumdlhz villa kulcsoshzdatahogyterm page2 degcpage templateselection formatreposelectiondegcxurl xurlprogramajnlatodplieii de josanimate28trkp9datatype jsontipus panzi hoteldataitemstelepls biledefact1defactccsomagajnlatactionnv szerintajnlatafunctioneroscrolltopplaiesii de sussuccess functionxdatatekintsd meg ajnlatunkat965412gurl xurllorem ipsum dolorintervalloader 030formswformcheckbuttontextcurrextalapkilltsmathexpscalerange0 10000booknewpglorem ipsumjson delay 250cozmeni lzrfalva2000nbsp klyhamzeumjos kszonaltzplieiireturn falseajax urlszllshelyedhotel dlhzsourcenbspuri1 thisattrrelmezgazdasgi szerszm struecozmeni lzrfalva lzretitelepls mindenparamspage processresultsparseintinpvalscrollcontaineranimate scrolltopomittedtermalapkillts nbsp800datasnehzreturntunad tusnddiszntoros dinomdnomlzrfalva lzretifoglald le nlunkhttpwwwszentannatorothis0hrefpanzi hotelblvnyosfrd bixad sepsibkszdgasztronmiamethodescapemarkup function markupmg tbb4napokminimuminputlength 1 templateresultkszonfeltz turia torjalefttusnd tusnaduszent annatuigetcozmenitpusaszerszm sescapemarkupfunction markup returnra 1delay 250mindtemplateresult formatrepo omittedvilla kulcsoshz aparthotelinfolivedialogcontainermarkup return markuphotelblvnyosfrdmathexp66 mathexpscalerange0 10000urlplusgyere scontentwindowfunctiontelepls minden teleplsturia torjatorja tunad tusndsearch termthisattrrelundefineds nbsp800 2000nbspklyhamzeumloadajaxurlfunctionmeg ajnlatunkat9654ifthisattrrel thisattrrelindexofleavescrolled 1q paramsterm searchdelay 250 datasetintervalfunctionprocessresults functionkszonfeltz turiapage return resultsbixadxdataminden tipusdisznvgsnewithisserializetusnadunou jtusndflipanimehide31return q paramstermnvcsomagajnlatod szllshelyedinpval2000nbsp klyhamzeum nbsp800formatrepofunction data page2 raifthisattrrel thisattrrelindexofleavescrolledclearintervalintervalvarannatdatatype json delayfunctioneventra 2 rashtml bodyanimatefunction16cskkozmsamig birod tekintsdszllshelypanzi hotel dlhzltnivalkszlls2000nbsp alapkillts nbsp800szmachangeallahreftipusreturn results dataitemswaitintervalinfinityisloggedin1sus kszonfeltzcolorparams10szolgltatkparamspageheightscrolltop 0jos kszonaltz plaiesiicsomagajnlatod szllshelyed programajnlatoddiszntoros dinomdnom gyere90a563processresults function dataparams return203diszntoroskszonaltz plaiesiikszonaltzordajnlata disznvgs sscrollcontaineranimatefunctionxurlsvgdoccsomagajnlatodfalse thisattrswtarget thisattrswincommentra 2mezgazdasgi25villaurl xurl xurl212000nbspdolorthisattrrelindexofleavescrolled 1tunad tusndfrd balvanyostusndfunctionevent uitipus panzitpusa mindenmethodtolowercase6thisattractionintervalloaderdefrec1defrecc26falsebodyanimatetusnadu nou jtusndinfoliveframekirndulsokxurlqformatreposelectionbreljbirod tekintsd megnbsp800 2000nbsp alapkilltspage templateselections nbsp800kulcsoshzaparthoteldinomdnom gyerevagykpturialzreti66 0gyere0 66 0roundpriceparseintscalerange1 mathexp66 mathexpscalerange0functionxurl changeonlyhrefminimuminputlength 1sepsibkszd cskkozms cozmenifunction markup2000nbsp alapkilltsnlunkparamsterm search term1 templateresult formatrepocurrentahrefelementtekintsd megintervalvarparseintinpval 14 gasztronmiasepsibkszdreloadpagefunction paramspricethisattrrelindexofleavescrolled 1 thisattrrel5 ramethodtolowercase getlocationhrefsearch term page250 data functiontevkenysgekegyligylcurrentibixad sepsibkszd cskkozmsdataitems escapemarkup functionnbsp800tunad tusndfrdipsum dolor loremfoglald14s egyligyldata functionescapemarkup functiondataitems escapemarkupfalse thisattrswtargettusnadu noudatatypedata pagelzrfalva lzreti plieiiszerintdonefunctiontypeofturia torja tunadbirodteleplsturisztikaifunction params returntemplateselectionbixad sepsibkszd66 0 5000023templateselection formatreposelectionhtdinomdnom gyere sinfolivedialogq paramstermmathexp66le nlunkcancontinuenlunk csomagajnlatod szllshelyeddlhz villaroundpriceparseintscalerange1paramspage processresults functionattacttocontainer truele22thisattrmethodtunad tusnd tusnaducskkozms cozmeni lzrfalvaminden tipus panzile nlunk csomagajnlatodhotel dlhz villakulcsoshz aparthotelajnlottalapkillts nbsp800 2000nbsps egyligyl amigmezgazdasgi szerszms diszntoros dinomdnomtemplateresult formatrepohtml bodyanimate scrolltopbalvanyos blvnyosfrd bixadegyligyl amig biroddtumaklyhamzeum nbsp800azdolor loremra 3brevityipsum24functionxdatamathexp66 mathexpscalerange015amig birodtusndfrd balvanyos blvnyosfrdparams return qfunction data18lorempage returnaction urlplusprocessresultsegyligyl amigreturn qhtmlpanziszllshelyekmgeventinitday17changeonlyhrefformatrepo omitteddefreccht ajnlata disznvgsresultsnbsp800 2000nbspiftypeofidifthisattrreldefactcfuncafterloginintervalvar setintervalfunction5settimeoutfunctionplaiesiibodyanimate scrolltop 0successtypebrevity seemathexpscalerange0bodyanimate scrolltopurltorja tunadincdescvaluetimeranimate heightchangefades waitintervalbooknewpg bookcurrpgmegfigyelsecskkozms cozmenireturn markupconsolelogscroll27yymmddresults dataitems escapemarkupdlhz7consolelognewht ajnlataajnlata disznvgssepsibkszd cskkozmsresults dataitemsajnlatotdata function paramsszerszmminimumresultsforsearch infinityipsum dolor03 rabile tunadomitted for brevityvilla kulcsoshzminden telepls bileprogramajnlatszolgltatsokhu250 dataszerszm s nbsp800defpricecagetypelzrfalvamarkuppagedateformat yymmddvarwidthfadetimeklyhamzeum nbsp800 2000nbsppage paramspage processresultsinpval parseintinpvalblvnyosfrd bixadurl actionpage paramspageszentseenbsp nbsp nbspreturn resultskrekbalvanyos1 50esemny2 ltnivalkdefaultcontainerheightdelaydata page returnra 5 radinomdnomajnlatunkat9654paramstermcustomcontentshtmlreloadcurrentpageajaxjtusnd13templateresultmegchangefadesraminimumresultsforsearchistinyinfolive falsesearchskoi0 szllshelyekamigdolor lorem ipsumfoglald ledatecurrentahrefelement this settimeoutfunctionthisattrswtarget thisattrswincommenttelepls bile tunadnlunk csomagajnlatodtusndfrdminimuminputlengthmarkup returntusndfrd balvanyosparamsterm searchtbbjsonbirod tekintsdhistorypushstate219tekintsdelsethisattrswtargettusnd tusnadu nouhistorypushstate urlminden telepls8attacttocontainer

Longtail Keyword Density for Szentanna-to.ro

KeywordsOccurences
nbsp nbsp nbsp19
html bodyanimate scrolltop5
ht ajnlata disznvgs4
json delay 2504
return q paramsterm4
params return q4
function params return4
data function params4
250 data function4
ajnlata disznvgs s4
66 0 500004
datatype json delay4
paramsterm search term4
0 66 04
mathexp66 mathexpscalerange0 100004
roundpriceparseintscalerange1 mathexp66 mathexpscalerange04
ra 5 ra4
ra 4 ra4
ra 3 ra4
q paramsterm search4
term page paramspage4
search term page4
templateresult formatrepo omitted4
false thisattrsw-target thisattrsw-in-comment4
bodyanimate scrolltop 04
thisattrrelindexofleave-scrolled -1 thisattrrel4
ifthisattrrel thisattrrelindexofleave-scrolled -14
page templateselection formatreposelection4
see the source4
omitted for brevity4
markup return markup4
villa kulcsoshz aparthotel4
function markup return4
escapemarkup function markup4
dataitems escapemarkup function4
results dataitems escapemarkup4
return results dataitems4
function data page4
processresults function data4
ra 2 ra4
delay 250 data4
dlhz villa kulcsoshz4
birod tekintsd meg4
tusndfrd balvanyos blvnyosfrd4
tunad tusndfrd balvanyos4
bile tunad tusndfrd4
telepls bile tunad4
hotel dlhz villa4
telepls minden telepls4
tekintsd meg ajnlatunkat96544
amig birod tekintsd4
blvnyosfrd bixad sepsibkszd4
egyl-igyl amig birod4
s egyl-igyl amig4
gyere s egyl-igyl4
dinom-dnom gyere s4
diszntoros dinom-dnom gyere4
s diszntoros dinom-dnom4
disznvgs s diszntoros4
balvanyos blvnyosfrd bixad4
minden telepls bile4
bixad sepsibkszd cskkozms4
plaiesii de sus4
tusnd tusnadu nou4
tusnadu nou jtusnd4
tunad tusnd tusnadu4
torja tunad tusnd4
turia torja tunad4
kszonfeltz turia torja4
tpusa minden tipus4
sus kszonfeltz turia4
minden tipus panzi4
jos kszonaltz plaiesii4
plieii de jos4
lzrfalva lzreti plieii4
cozmeni lzrfalva lzreti4
tipus panzi hotel4
cskkozms cozmeni lzrfalva4
sepsibkszd cskkozms cozmeni4
panzi hotel dlhz4
foglald le nlunk3
currentahrefelement this settimeoutfunction3
dolor lorem ipsum3
ipsum dolor lorem3
lorem ipsum dolor3
csomagajnlatod szllshelyed programajnlatod3
nlunk csomagajnlatod szllshelyed3
le nlunk csomagajnlatod3
s nbsp800 2000nbsp3
klyhamzeum nbsp800 2000nbsp3
2000nbsp klyhamzeum nbsp8003
nbsp800 2000nbsp klyhamzeum3
alapkillts nbsp800 2000nbsp3
2000nbsp alapkillts nbsp8003
nbsp800 2000nbsp alapkillts3
page paramspage processresults3
szerszm s nbsp8003
mezgazdasgi szerszm s3
1 templateresult formatrepo3
minimuminputlength 1 templateresult3
page return results3
data page return3
paramspage processresults function3
url xurl xurl3
nbsp nbsp25
scrolltop 09
nbsp800 2000nbsp9
0 szllshelyek8
ajax url8
return false7
nv szerint7
tpusa minden7
action urlplus6
historypushstate url6
html bodyanimate5
attacttocontainer true5
success functionxdata5
szent anna-t5
lorem ipsum5
bodyanimate scrolltop5
return q4
ht ajnlata4
q paramsterm4
function params4
paramsterm search4
search term4
term page4
page paramspage4
params return4
json delay4
data function4
250 data4
ajnlata disznvgs4
function data4
datatype json4
0 500004
66 04
0 664
mathexpscalerange0 100004
processresults function4
return markup4
data page4
templateselection formatreposelection4
url action4
methodtolowercase get4
thisattrsw-target thisattrsw-in-comment4
false thisattrsw-target4
-1 thisattrrel4
thisattrrelindexofleave-scrolled -14
ifthisattrrel thisattrrelindexofleave-scrolled4
parseintinpval 14
inpval parseintinpval4
page templateselection4
return results4
brevity see4
formatrepo omitted4
templateresult formatrepo4
minimuminputlength 14
roundpriceparseintscalerange1 mathexp664
markup return4
function markup4
escapemarkup function4
dataitems escapemarkup4
results dataitems4
mathexp66 mathexpscalerange04
delay 2504
animate height4
telepls bile4
lzreti plieii4
lzrfalva lzreti4
cozmeni lzrfalva4
cskkozms cozmeni4
sepsibkszd cskkozms4
bixad sepsibkszd4
blvnyosfrd bixad4
balvanyos blvnyosfrd4
tusndfrd balvanyos4
tunad tusndfrd4
5 ra4
minden telepls4
kszonaltz plaiesii4
telepls minden4
meg ajnlatunkat96544
tekintsd meg4
birod tekintsd4
amig birod4
egyl-igyl amig4
s egyl-igyl4
gyere s4
dinom-dnom gyere4
diszntoros dinom-dnom4
s diszntoros4
disznvgs s4
jos kszonaltz4
bile tunad4
sus kszonfeltz4
panzi hotel4
2 ra4
1 ra4
ra 34
3 ra4
ra 44
dlhz villa4
4 ra4
ra 54
kulcsoshz aparthotel4
villa kulcsoshz4
hotel dlhz4
ra 24
ra 14
tipus panzi4
minden tipus4
nou jtusnd4
tusnadu nou4
tusnd tusnadu4
tunad tusnd4
torja tunad4
turia torja4
kszonfeltz turia4
intervalvar setintervalfunction3
intervalloader 03
changefades waitinterval3
scrollcontaineranimate scrolltop3
minimumresultsforsearch infinity3
ipsum dolor3
functionxurl changeonlyhref3
url xurl3
xurl xurl3
istinyinfolive false3
dolor lorem3
szllshelyed programajnlatod3
2 ltnivalk3
alapkillts nbsp8003
paramspage processresults3
1 templateresult3
1 503
2 degc3
mezgazdasgi szerszm3
szerszm s3
s nbsp8003
2000nbsp alapkillts3
2000nbsp klyhamzeum3
4 gasztronmia3
klyhamzeum nbsp8003
foglald le3
le nlunk3
nlunk csomagajnlatod3
csomagajnlatod szllshelyed3
page return3
mg tbb3
dateformat yy-mm-dd3
booknewpg bookcurrpg3
functionevent ui3
064
function59
napok58
false40
138
return37
true35
ra34
nbsp32
s20
var19
settimeoutfunction18
else18
url17
216
undefined15
315
scrolltop13
action13
minden13
gasztronmia12
ltnivalk12
page12
data12
szllshelyek12
iftypeof12
411
height10
currenti10
currext10
sepsibkszd9
kszonaltz9
lzrfalva9
tusnd9
torja9
tusndfrd9
cskkozms9
esemny9
ajax9
2000nbsp9
szolgltatk9
nbsp8009
blvnyosfrd9
thisattrrel8
telepls8
this0href8
thisattrsw-target8
price8
markup8
szerint8
58
68
parseintinpval8
tunad8
78
booknewpg7
typeof7
87
tpusa7
97
nv7
107
xurl7
szent7
get7
116
historypushstate6
thisserialize6
126
ht6
136
urlplus6
146
inpval6
loadajaxurlfunction6
dtuma6
functionxdata6
mind6
formatreposelection5
left5
success5
anna-t5
formsw-form-check5
xdata5
szlls5
ipsum5
consolelognew5
buttontext5
esemnyek5
functione5
hu5
html5
bodyanimate5
newi5
lorem5
attacttocontainer5
changefades5
155
formatrepo5
changeonlyhref5
165
templateresult4
omitted4
paramspage4
minimuminputlength4
escapemarkup4
dataitems4
results4
processresults4
see4
istinyinfolive4
infolivedialogcontainer4
term4
search4
paramsterm4
q4
brevity4
defrecc4
source4
thisattrmethod4
thisattrrelindexofleave-scrolled4
skoi4
cancontinue4
reloadpage4
customcontentshtml4
currentahrefelement4
intervalvar4
waitinterval4
uri4
bookcurrpg4
thisattrsw-in-comment4
agetype4
templateselection4
locationhref4
defact1defactc4
defactc4
defprice1defpricec4
defpricec4
defrec1defrecc4
ifthisattrrel4
degc4
methodtolowercase4
defaultcontainerheight4
datas4
type4
params4
animate4
174
plaiesii4
balvanyos4
bixad4
cozmeni4
lzreti4
plieii4
delay4
sus4
tbb4
kszonfeltz4
turia4
tusnadu4
nou4
jtusnd4
tipus4
panzi4
bile4
mg4
dlhz4
birod4
ajnlata4
disznvgs4
diszntoros4
dinom-dnom4
gyere4
egyl-igyl4
amig4
tekintsd4
kp4
meg4
ajnlatunkat96544
184
194
204
color4
szolgltatsok4
hotel4
jos4
villa4
csomagajnlat4
nehz4
214
krek4
224
234
roundpriceparseintscalerange14
kirndulsok4
mathexp664
tevkenysgek4
mathexpscalerange04
244
programajnlat4
megfigyelse4
ellts4
aparthotel4
kulcsoshz4
json4
fvalue4
datatype4
g3
253
svgdoc3
90a5633
263
273
jpg3
infoliveframe3
ord3
283
dateformat3
method3
thisattraction3
ajnlatot3
infolivedialog3
ro3
functionevent3
ui3
infinity3
minimumresultsforsearch3
a-z3
id3
functionxurl3
scrollcontaineranimate3
consolelogscroll3
changeallahref3
yy-mm-dd3
donefunction3
293
szllshelyed3
width3
flipanimehide3
szllshely3
mezgazdasgi3
incdescvaluetimer3
programajnlatod3
csomagajnlatod3
brelj3
nlunk3
le3
foglald3
szerszm3
eventinitday3
klyhamzeum3
httpwwwszentanna-toro3
dolor3
hogy3
reloadcurrentpageajax3
trkp3
vagy3
alapkillts3
contentwindowfunction3
setintervalfunction3
clearintervalintervalvar3
ajnlott3
fadetime3
funcafterlogin3
isloggedin3
szma3
303
date3
intervalloader3
turisztikai3
313

What are the nameservers for szentanna-to.ro?

Szentanna-to.ro Domain Nameserver Information

HostIP AddressCountry
ns1.secdns.eu 94.125.177.11Hungary Hungary
ns2.secdns.eu 91.82.237.110Hungary Hungary
ns3.secdns.eu 195.201.61.195Russia Russia
ns4.secdns.eu 5.56.33.70Hungary Hungary

Szentanna-to.ro Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Szentanna-to.ro is a scam?