Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-29
Domain label
takeawaysandefjord
Domain extension
no
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Takeawaysandefjord.no registered?
A: Takeawaysandefjord.no was registered 3 months, 3 weeks, 1 day, 2 hours, 28 minutes, 1 second ago on Saturday, May 29, 2021.
Q: When was the WHOIS for Takeawaysandefjord.no last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 1 day, 2 hours, 28 minutes, 1 second ago on Saturday, May 29, 2021.
Q: What are Takeawaysandefjord.no's nameservers?
A: DNS for Takeawaysandefjord.no is provided by the following nameservers:
  • ns2.hyp.net
  • ns1.hyp.net
  • ns3.hyp.net
Q: Who is the registrar for the Takeawaysandefjord.no domain?
A: The domain has been registered at .
Q: What is the traffic rank for Takeawaysandefjord.no?
A: Takeawaysandefjord.no has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Takeawaysandefjord.no each day?
A: Takeawaysandefjord.no receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Takeawaysandefjord.no resolve to?
A: Takeawaysandefjord.no resolves to the IPv4 address 81.27.38.33.
Q: In what country are Takeawaysandefjord.no servers located in?
A: Takeawaysandefjord.no has servers located in the Germany.
Q: What webserver software does Takeawaysandefjord.no use?
A: Takeawaysandefjord.no is powered by webserver.
Q: Who hosts Takeawaysandefjord.no?
A: Takeawaysandefjord.no is hosted by Host Europe GmbH in Germany.
Q: How much is Takeawaysandefjord.no worth?
A: Takeawaysandefjord.no has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Takeawaysandefjord.no Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Takeawaysandefjord.no Free SEO Report

Website Inpage Analysis for Takeawaysandefjord.no

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-24979564-13

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Takeawaysandefjord.no

stavangerdrammen take awayoslolarvikhorsenstakegvleporsgrunnaway brumam mainmapjnkpingaway lillestrmpizzaroskildedresdensilkeborgkontaktbestellenhamburgstockholmbrum take awayfrankfurt amamkbenhavnrandershelsingborgsandefjordgteborghannoverduisburgtake away brumaalborgsandnesfredrikstadrebrohelsingrtakeawaylieferservicelinkpingbergentake awayumehaugesundessen bestellenuppsalakoldingfrankfurt am mainhamarlieferdienstsdertljekristiansanddsseldorfklnvstersodensetnsbergborsrhusskienaskerbodleipzigherningesbjergrestaurantnrnberggjvikfredericialillestrm taketake away drammennbspnstvedessenbremenberlintromstrondheimawaymaindrammenbrum takesarpsborgcateringmnchentakeawaysandefjordnodortmunddrammen takestuttgartnorrkpinglesundlillestrm take awayaway drammenomfrankfurttake away lillestrmogbrummalmlillestrmvejlelillehammervarnewlund

Longtail Keyword Density for Takeawaysandefjord.no

KeywordsOccurences
take away brum3
brum take away3
take away drammen3
drammen take away3
take away lillestrm3
lillestrm take away3
frankfurt am main3
take away161
essen bestellen4
away brum3
brum take3
away drammen3
drammen take3
away lillestrm3
lillestrm take3
frankfurt am3
am main3
take162
away161
catering55
pizza28
var16
lieferdienst14
new9
sandefjord8
lieferservice8
essen7
oslo6
bergen6
troms5
restaurant5
dsseldorf5
brum5
lillestrm5
mnchen5
kln5
nrnberg5
ume4
sdertlje4
helsingr4
rebro4
esbjerg4
aalborg4
vsters4
horsens4
herning4
bremen4
kolding4
kbenhavn4
odense4
roskilde4
vejle4
rhus4
linkping4
dortmund4
bestellen4
stuttgart4
norrkping4
malm4
jnkping4
stavanger4
drammen4
map4
bors4
bod4
asker4
haugesund4
hamar3
gjvik3
fredrikstad3
dresden3
duisburg3
frankfurt3
takeawaysandefjordno3
am3
main3
hamburg3
hannover3
leipzig3
kontakt3
om3
nbsp3
berlin3
kristiansand3
lund3
trondheim3
takeaway3
helsingborg3
stockholm3
gteborg3
gvle3
uppsala3
lesund3
tnsberg3
fredericia3
silkeborg3
skien3
sarpsborg3
sandnes3
porsgrunn3
nstved3
lillehammer3
randers3
larvik3
og3

Who hosts Takeawaysandefjord.no?

Takeawaysandefjord.no Hosting Provider Information

Hosted IP Address:81.27.38.33
Hosted Hostname:eiendomsmeglerguiden.no
Service Provider:Host Europe GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Not Applicable

Is "Host Europe GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Host Europe GmbH
1.1421%

HTTP Header Analysis for Takeawaysandefjord.no

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 29 May 2021 08:44:49 GMT
Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.25
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html

Takeawaysandefjord.no Domain Nameserver Information

HostIP AddressCountry
ns2.hyp.net 151.249.125.2
ns1.hyp.net 151.249.124.1
ns3.hyp.net 151.249.126.3


Need to find out who hosts Takeawaysandefjord.no?


Domain Registration (WhoIs) information for Takeawaysandefjord.no

 % By looking up information in the domain registration directory
% service, you confirm that you accept the terms and conditions of the
% service:
% https://www.norid.no/en/domeneoppslag/vilkar/
%
% Norid AS holds the copyright to the lookup service, content,
% layout and the underlying collections of information used in the
% service (cf. the Act on Intellectual Property of May 2, 1961, No.
% 2). Any commercial use of information from the service, including
% targeted marketing, is prohibited. Using information from the domain
% registration directory service in violation of the terms and
% conditions may result in legal prosecution.
%
% The whois service at port 43 is intended to contribute to resolving
% technical problems where individual domains threaten the
% functionality, security and stability of other domains or the
% internet as an infrastructure. It does not give any information
% about who the holder of a domain is. To find information about a
% domain holder, please visit our website:
% https://www.norid.no/en/domeneoppslag/

Domain Information

NORID Handle...............: TAK1124D-NORID
Domain Name................: takeawaysandefjord.no
Registrar Handle...........: REG42-NORID
Tech-c Handle..............: DH38R-NORID
Name Server Handle.........: NSHY11H-NORID
Name Server Handle.........: NSHY46H-NORID
Name Server Handle.........: NSHY81H-NORID
DNSSEC.....................: Signed
DS Key Tag 1...........: 30998
Algorithm 1...........: 13
Digest Type 1...........: 2
Digest 1...........: b2c1f6aeafb1dc811c74c8132f2362ee0761787c9debbac8f150fba1ebb64251
DS Key Tag 2...........: 30998
Algorithm 2...........: 13
Digest Type 2...........: 4
Digest 2...........: 1664ac80b0d67c700b91605dd5dc963c66fd95d929f4111b5c0d5ff7dbc72ea918a7862ec14678001454f2af8d335915

Additional information:
Created: 2012-02-28
Last updated: 2021-02-17

Websites with Similar Names

Takea.date
Félicitations ! Votre domaine a bien été créé chez OVH !
Takea.ru
Оформление соц.сетей YouTube, Вконтакте, Facebook, Instagram, Twitter, Twitch — TakeArt
Takea.xyz
Welcome to takea.xyz
Takea10okw.club
takea10okw.club
Takea10okw.info
takea10okw.info - Registered at Namecheap.com

Recently Updated Websites

Allfiles.moy.su (2 seconds ago.)Smithauctionsllc.com (3 seconds ago.)Altruwest.com (4 seconds ago.)Changerlesysteme.org (7 seconds ago.)Slovakbasket.sk (8 seconds ago.)Konrad-maria-engel.de (9 seconds ago.)Syfolyme.xyz (10 seconds ago.)Cuc.ru (10 seconds ago.)Kineticusa.com (10 seconds ago.)Clevelandimagyarokert.org (11 seconds ago.)Xxerotica.com (11 seconds ago.)Danielrozo.es (11 seconds ago.)Xxxdesi.com (12 seconds ago.)Uocw.org (14 seconds ago.)Izao.fr (15 seconds ago.)Efscoach.com (16 seconds ago.)Allergyfear.com (17 seconds ago.)Paperfluent.com (18 seconds ago.)Bondagebdsmporn.com (18 seconds ago.)Onlinecitationpayment.com (19 seconds ago.)Aculaz.com (20 seconds ago.)Pinnaclesynergy.info (20 seconds ago.)Speakeress.com (21 seconds ago.)Sesc-sc.com.br (23 seconds ago.)Sms-peru.com (25 seconds ago.)Santhom.org (26 seconds ago.)Rexrealtor.net (27 seconds ago.)Festfanatic.com (27 seconds ago.)Leonaamargaexpeditions.com (27 seconds ago.)Here2home.info (29 seconds ago.)

Recently Searched Keywords

managing work-life balance is like walking on the edge for women entrepreneurs (1 second ago.)gemma arterton instagram (1 second ago.)emi on credit card axis bank (1 second ago.)what is consent (2 seconds ago.)jet 2 news (2 seconds ago.)…и гитлер без усов (3 seconds ago.)actualitã© football (3 seconds ago.)premium_iconriverside camping prompts backlash from ministerspoll allowing camping on river frontages presents serious environmental and cultural risks, dissenting government ministers say — and they’re making that known. combined shape (4 seconds ago.)docketing (4 seconds ago.)wipeyourbrow (5 seconds ago.)0 not (5 seconds ago.)blackberry messenger (6 seconds ago.)ex servicemen meaning in marathi (8 seconds ago.)rsshover (9 seconds ago.)03.10.2019 (9 seconds ago.)okumaya devam et (10 seconds ago.)node (11 seconds ago.)heart school (12 seconds ago.)ogden (13 seconds ago.)theon greyjoy death (14 seconds ago.)汽车配件店 (14 seconds ago.)bentley bmw (14 seconds ago.)the strecker synthesis of amino acids (15 seconds ago.)ðžð±ñƒð²ñŒ (16 seconds ago.)lea van winkle (17 seconds ago.)watykan: przez cały listopad będzie można uzyskać odpust dla zmarłych (19 seconds ago.)young action super funky ride (19 seconds ago.)danmarks ældste grav (19 seconds ago.)insurance bad faith claims (20 seconds ago.)be part of the movement → (20 seconds ago.)