Live & Interactive Learning - Talentedge | Online Executive Certification Courses for Working Professionals

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: 699,059
Estimated Worth: $107,400

Enhance your career with best online certification courses and online professional certificate programs for working professionals at Talentedge, an e-Learning ed-tech firm. We partnered with premium academic institutes of India.



Domain summary

Last updated
2021-04-06
Domain label
talentedge
Domain extension
in
Domain registered:
2012-02-17
Domain updated:
2013-02-19
Domain expires:
2023-02-17
Global Traffic Rank
699,059
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$107,400
Estimated daily income
$179
Estimated monthly income
$5,445

Rank summary

How is talentedge.in ranked relative to other sites:

Percentage of visits to talentedge.in from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Talentedge.in registered?
A: Talentedge.in was registered 9 years, 2 months, 1 day, 23 hours, 1 minute, 14 seconds ago on Friday, February 17, 2012.
Q: When was the WHOIS for Talentedge.in last updated?
A: The WHOIS entry was last updated 8 years, 1 month, 3 weeks, 6 days, 23 hours, 1 minute, 14 seconds ago on Tuesday, February 19, 2013.
Q: What are Talentedge.in's nameservers?
A: DNS for Talentedge.in is provided by the following nameservers:
  • ns-332.awsdns-41.com
  • ns-971.awsdns-57.net
  • ns-2009.awsdns-59.co.uk
  • ns-1291.awsdns-33.org
Q: Who is the registrar for the Talentedge.in domain?
A: The domain has been registered at .
Q: What is the traffic rank for Talentedge.in?
A: Talentedge.in ranks 699,059 globally on Alexa. Talentedge.in has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Talentedge.in each day?
A: Talentedge.in receives approximately 14,342 visitors and 71,710 page impressions per day.
Q: What IP address does Talentedge.in resolve to?
A: Talentedge.in resolves to the IPv4 address 103.241.181.21.
Q: In what country are Talentedge.in servers located in?
A: Talentedge.in has servers located in the India.
Q: What webserver software does Talentedge.in use?
A: Talentedge.in is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Talentedge.in?
A: Talentedge.in is hosted by CtrlS Datacenters Ltd. in India.
Q: How much is Talentedge.in worth?
A: Talentedge.in has an estimated worth of $107,400. An average daily income of approximately $179, which is roughly $5,445 per month.

Talentedge.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Talentedge.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Talentedge.in

H1 Headings

2 :
  1. PREMIUM EXECUTIVE COURSES TO ENHANCE YOUR CAREER
  2. Fee Structure

H2 Headings

14 :
  1. Talentedge
  2. Browse Courses
  3. Popular Courses
  4. Talentedge Way
  5. GIVE WINGS TO YOUR CAREER ASPIRATIONS
  6. MEET YOUR FACULTY
  7. ENTERPRISE SOLUTION
  8. LEARNERS SPEAK
  9. AWARDS & AFFILIATIONS
  10. Talk to our counsellors to find a course best for your career
  11. No Cost EMI - 9 Months
  12. Standard EMI - 12 Months
  13. Standard EMI - 18 Months
  14. Standard EMI - 24 Months

H3 Headings

44 :
  1. HR
  2. Analytics
  3. Strategy & Leadership
  4. Business Management
  5. Brand Sales & Marketing
  6. Finance
  7. Supply Chain Management
  8. Digital Marketing
  9. HR Management
  10. Data Science using Excel & R
  11. Marketing Strategy
  12. Digital Marketing
  13. Digital Marketing
  14. HR Management
  15. HR Management
  16. Data Science using Excel & R
  17. Data Science using Excel & R
  18. Marketing Strategy
  19. Marketing Strategy
  20. Online Live Face-to-Face learning
  21. Learn from eminent faculty from globally leading institutes
  22. Recreating classroom-type interactions in the digital world
  23. Career Advancement Services by Right Management
  24. Sudhir Banerjee
  25. Mahesh Gupta
  26. Navanit Samaiyar
  27. Naveen Jain
  28. Sudhir Banerjee
  29. Mahesh Gupta
  30. Navanit Samaiyar
  31. Naveen Jain
  32. Askpro
  33. Checkout our Mobile Apps
  34. Dr. Falguni Vasavada-Oza
  35. Dr. Rojers P Joseph
  36. Dr. R. K. Premarajan
  37. Dr. Rajat Sharma
  38. Dr. Falguni Vasavada-Oza
  39. Dr. Rojers P Joseph
  40. Dr. R. K. Premarajan
  41. Dr. Rajat Sharma
  42. Hi There,
  43. Let us call you back
  44. Call us

H4 Headings

64 :
  1. Off Campus
  2. Campus
  3. Business Management
  4. Finance
  5. Brand Sales & Marketing
  6. Analytics
  7. Strategy & Leadership
  8. HR
  9. Technology & IT
  10. Supply Chain Management
  11. Project Management
  12. Business Management
  13. Finance
  14. Brand Sales & Marketing
  15. Analytics
  16. Strategy & Leadership
  17. HR
  18. Technology & IT
  19. Supply Chain Management
  20. Project Management
  21. Campus
  22. Off Campus
  23. Machine Learning
  24. Digital Marketing
  25. Media & Entertainment
  26. Cyber Security
  27. Entrepreneurship
  28. Strategy & Leadership
  29. Analytics
  30. HR
  31. Technology & IT
  32. Masters of Business Administration
  33. Strategy & Leadership
  34. Analytics
  35. HR
  36. Technology & IT
  37. Masters of Business Administration
  38. MICA
  39. XLRI Jamshedpur
  40. XLRI Jamshedpur
  41. IIM Lucknow
  42. MICA
  43. MICA
  44. XLRI Jamshedpur
  45. XLRI Jamshedpur
  46. XLRI Jamshedpur
  47. XLRI Jamshedpur
  48. IIM Lucknow
  49. IIM Lucknow
  50. Global Business Director
  51. Chairman
  52. COO
  53. CEO
  54. Global Business Director
  55. Chairman
  56. COO
  57. CEO
  58. Abhinav Nayyar
  59. Girish Gupta
  60. Kalicharan Sharma
  61. Maya Aripirala
  62. Mugdha Vartak
  63. Checkout our Mobile Apps
  64. Talentedge

H5 Headings

25 :
  1. Honeywell
  2. KENT RO Systems Ltd
  3. Star Dental Centre Pvt. Ltd
  4. TransOrg Analytics
  5. Honeywell
  6. KENT RO Systems Ltd
  7. Star Dental Centre Pvt. Ltd
  8. TransOrg Analytics
  9. Team Lead - Content , AdGlobal360
  10. CP-02-0715-001
  11. Oct 2016 Batch
  12. Oct 2016 Batch
  13. Jan 2016 Batch
  14. Jan 2016 Batch
  15. Jan 2016 Batch
  16. Jan 2016 Batch
  17. Strategic HR Consultant , Vector Informatik India Pvt Ltd.
  18. Aug 2016 Batch
  19. Home
  20. Talentedge
  21. Courses
  22. Usage
  23. Learner
  24. Reach Us
  25. We'll contact you ASAP

H6 Headings

9 :
  1. IT & ITES
  2. Entrepreneurship
  3. Healthcare
  4. Analytics
  5. IT & ITES
  6. Entrepreneurship
  7. Healthcare
  8. Analytics
  9. Call us to get more information

Total IFRAMEs

3 :

Total Images

70 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

459:

Links - Outbound (nofollow)

0:

Keyword Cloud for Talentedge.in

analyticsadmission openofviet namvirginopen executive86px height 86pxmincharsislandssomaliasouthtalent management xlripradesharunachallucknowuserimportant divuserpro974gfglobal35s easeinout fontweight120px divuserpro857dr falgunitestingnadutripurauttarakhanduttar pradeshwestr xlri jamshedpur48px top 48pxcontent marketinguserprobuttononclickfunctionuserprofieldbillingstatetemp selectvalucla10px 15pxleadership indiastandard emi standardsecurityxlri jamshedpur iimmarianamanagement global supplyrohtak iim rohtakzindex99 callmodalhpopen talent managementdownpayment gst loaninput divuserprochain management global5programsofmadagascarmalawimalaysiamaldivesmalimaltamarshallk premarajanbarthlemysaintmarginleft 30pxguineaeritreaestoniaethiopiafalkland islands malvinasfaroefunctionresponseamount with gstindustryhuman resources managementphonenumbernewprogram in projectguineaeritreaestoniaethiopiafalklandinnovation and entrepreneurshipguidestateandhra pradesharunachalborderradius 999pxpython excel rtop 48px divuserproawsmpicendaddsadmissionselectonchangefunction registerdiv userprofieldbillingstatetempcaledonianew zealandnicaraguanigernigerianiuenorfolkadmissionoff campusamp marketing managementmarketing digital marketing15pxcookiestripbar1px solid d3d3d3da cunhasaintclicktocall numberislands britishvirgin islandsleadership strategic managementtransform translate50 50resources managementadmissionstate selectundefinedimg width 86pxread more drinputhover callmodalplurinational state ofbonaireuserprofieldfirstname120px divuserpro979leadership businessdivuserprolabelbetweenislandsuruguayuzbekistanvanuatuvenezuelaimportant maxheight 14pxalignitems centerletterspacingnormalusingmonths programacca skills coursebilling laststrategic management iimdigital marketing digitalresearch and datajanopen businesspassword divuserproawsmpic marginleftfinancial accounting auditing10px 0 0productslearning machine learningmanagement coursesadmission open machineocean territorybruneiopen digitalsocialinner ul lipinterestanalytics 360admissionformerpm istislamic republic ofiraqirelandisleinputselectvalpassword username48px divuserproawsmpiccstcpiiithtmlmargintopifregisterdiv userprofieldbillingstatetempmcdonaldspanstrategic humanstatesunited states minorname billing cityauserprouserimg spananalytics marketingjan mayenswazilandswedenswitzerlandsyrian arabecommerceemail linkedin emailtrue minchars 3leadershipadmission open humanabsolutefederationrwandasaintmanagers iimusername or emaildivuserpromsgoverlaycontent textarea50px heightstandard emiricoqatarrunionromaniarussian federationrwandasaint barthlemysaintiim raipurwarriormanagementexecutive developmentadmission open pgcmanagementadmission open businessislandssomaliasouth africasouthusrelativelevelssudanspainsriadmission open executivestartedgetpictureupload a profileedit profile emailprivacy policyentrepreneurshipviewmaster of businessresource managementcourses best suited120pxlast name emailinput divuserpro textareauserprofieldbillingstatetemphide registerdiv userprofieldbillingstateshowmedia screenpublicmargin 0 autouserprofieldbillingstate inputval ifthisvalindiatextarea divuserpronotifier fontfamilyfederationrwandasaint barthlemysaintclicktocall number inputfocusoutlinenoneankit fadiabilling last nameforgot password divuserproawsmpicul lilinkedinresourcesemi standard emiscreen and maxwidthopen advertising managementpadding0managementadmission open mastersmaxheightusing excel ruserprofieldbillingstatetempappendthis fieldlistafooterquicklinksactiondisplayinlineblock positionrelativepassword forgotbackground f4f4f4width 50pxpadding 0performance managementbarthlemysaint helena ascensionarab republictaiwaniim lucknowofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew86px divuserproemail antispam questionanswerredeminentproject managementdigital transformationadmission openopen masterscountryafghanistanland islandsalbaniaalgeriaamericanpython knowledge0pxtop 120pxdiudelhilakshadweeppuducherry referreduserprofieldbillingstatetempshow registerdiv userprofieldbillingstatehide5pxdivuserpromsgoverlaycontent input divuserpromsgoverlaycontent000formcontrolafricanregisterdivzindexacademicrtoolsacca skillssalvadorequatorial guineaeritreaestoniaethiopiafalklandascent collegemartin frenchvisitornamecombo offeriim rohtakdivuserprouserarabofferadmission openindia value addshr analyticsamp it machinebigminor2016 batchdivuserpronotifier fontfamilypost urlcertified cyber warriorfieldbolivarian republicadvertising managementethicalsales marketing managementinput divuserpromsgoverlaycontent0px importantofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew caledonianew zealandnicaraguanigernigerianiuenorfolkislandnorthernleadership change managementrepublic ofiraqirelandisledivemduser0 0 05padding 10px 0sintdivuserproonlineitemi widthprogram in machineda cunhasaint kittsfff14px importantdaymaskbghidemaarten dutch partslovakiasloveniasolomonprofileaddressbillingscience onlinebangalorevincentmarginleft 30px marginrightclose logsudanspainsri lankasudansurinamesvalbardcunhasaintprnicobarchandigarhdadra and nagardelhiall 05scountryafghanistanland islandsalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantiguastrategy amp leadershipuserprofieldbillingstatetemphide registerdivdivuserproonlineitem borderbottomuserprofieldbillingstateifregisterdivassessment centersricoqatarrunionromaniarussianmedia entertainment managementmarginleft 48px topscience using excel120px divuserpro471jamshedpur admissioniim rohtak iimdivuserprouser auserprouserimg widthdivuserproprofileimg width 80pxnicobarchandigarhdadrayou5000 return elsespan topmica admissionpgchiddenmodeacca professional courseborderbottom 0pxwidth 22 marginleftinternational financialitsenteradmission open supplyunited0boxshadow noneborderradius2pxtomeentrepreneurship iim rohtakstrategic management hropen supplycopal amba financialforgotvalue addsadmission openisland and mcdonaldstatesunitednamvirgin islands britishvirginchain managementcolorfff socialinnersaharayemenzambiazimbabwe billing stateifthisval registerdiv userprofieldbillingstatetemprighttrends in marketinginputval ifthisvalindiaallfutunawestern saharayemenzambiazimbabwe billingentrepreneurship iimresearchoptionbox table tdmaxwidth 480px marginleft480pxresourceislandbrazilbritish indian oceanmanagement financefontweight boldcitycertification courseopen strategic humanimportant divuserpro471skillingmanagement amptraditionalleadership ecornellamp changelast name billingjamshedpur admission openrepublic ofkorea republiclucknow advanced48px topamp supplyselect stateandhra pradesharunachaldr ranalytics analyticssalvadorequatorial guineaeritreaestoniaethiopiafalkland islandsregisterdiv userprofieldbillingcountry selectonchangefunctionopen ecommerce businesslearning digitaldivuserpronotifiersocial media strategytexttransform uppercasemember firstenterpriseyugoslav republicimportant dontnevissaint luciasaint martinsocialinner ul lilinkedinphone edittextarea divuserprocaicos islandstuvaluugandaukraineunitedcalltoactionssalesgst loan amountauditingtextdecorationnoneexcel rsenior managersislandssouth sudanspainsriadmission open hrfinancial5px paddingcorporate financemiquelonsaint vincentprocessingkozhikode admissioniim bangaloremanagers xlribeen scheduledopencyber securityfederateddahuman resource managementcyber warriorfontsize 12pxdivuserpro814 divuserproonlineitemdigital marketingoff campus mastersdivuserprouserlink widthgrenadinessamoasan marinosaolearning big dataanalytics admission opengeneralindustrial design innovationdisplay blockpradesharunachal pradeshassambiharchhattisgarhgoagujaratharyanahimachallivemarketing managementhave an account120px divuserpro471 divuserprouserprofile pictureuploadgenpactimportant divuserpro565financial risk managementadmissioninputfocusoutlinenone12px borderright1px dddeventdivuserproonlineitem borderbottom 0pxappliedmanagementexecutive certificate programdivuserprouserlink width 120pxborderbottom 0px importantdivuserpro814marketing vs digitalprogram in humanterritorybruneihttpstalentedgecomwpadminadminajaxphp data actionbackground fffgermany admissionborder 1px solidcapital leadershipadmission openofmoldovapopuppayoptlankasudansurinamesvalbard and janmarketing professional certificationemi 0pnthchildevenrepublictaiwanadministration iubh germanyzealandnicaraguanigernigerianiuenorfolk islandnortherninteractiveapplied financial risktalent managementarab emiratesunitednevissaint luciasaintmbadivuserproawsmpicbolivarianuserprofieldbillingstatetemp userprowarningremoveamp marketingonline certificationworkingmanagement public relationstextalign centersaharayemenzambiazimbabweleft 50addsadmission openborderradius 5pxposition absoluteeaseinout fontweight boldinputfocusoutlinenone importantdp processingleadership digitallinked programsiim lucknow marketingpradeshassambiharchhattisgarhgoagujaratharyanahimachallilinkedinmarketing communicationecornelldontpradesharunachal pradeshassambiharchhattisgarhgoagujaratharyanahimachal pradeshjammuyourstrategy iim lucknowautomargin 0 paddingtransform translate50entertainment mediaborderradius 5px paddingrepublicdenmarkdjiboutidominicadominican republicecuadoregypteldiudelhilakshadweeppuducherryeditspeak120px divuserpro979 divuserprouseropen pgccorporateuserprofieldbillingstatetempappendthisprincipesaudistate select stateandhramica admission openmba from ascentcaledonianew120px divuserpro655 divuserprouser120px lineheightvaticanislandsholyreasons startupshuman resource0border 0boxshadow noneborderradiuslipinterestfinancial statement0 autodisplayflex alignitemscenter10registerdiv userprofieldbillingstatetemphide registerdivmargintop 15px marginleftconference on assessmentadvertisingdigital marketingadmission openrepublic ofviet namvirgineaseinout transitiondivuserpro inputimportant already havesocialcertificatehuman capital leadershipbeenmangement15px marginleft0border 0boxshadowislandscolombiacomoroscongocongobusiness managementadmission open480px marginleftleadership ecornell admissionleadership executivehuman resourcessouth sandwichstatehondurashonghttpstalentedgecomwpadminadminajaxphpsvgfillmedialearning for managersadmissiondivuserpromsgoverlaycontentscrollsignupstatefieldsonchangefunction registerdiv userprofieldbillingstatemanagement project managementadmissionmarginleft 2 importantreturn else35s easeinout transitionsupportcallbackbuttonpropdisabled falseofkuwaitkyrgyzstanlao peoples democraticiim kozhikodesolidpositionabsolute zindex99administrationmarginleftoptionboxold pnthchildeven widthfontfamilydivuserproprofileimgtextareauserproeditor divuserpromsgoverlaycontent divuserpromsgoverlaycontentraipurdivuserprouser margintopblockchain14pf dppf downpaymentanalyticsexecutive developmentlearning in dataoptionbox table thd3d3d3logistics supply chainphonecallbottombar balooninputwidth100displayblockheight36px border1px dddjqueryajax typedownpayment dp processingmarinosao tomeimportant callmodal modalcontentabsolute width0boxshadowstates ofmoldovagst downpaymentcommunicationprayagraj admissionwidth 80pxrepublic ofkoreamsc maths phdmodalcontent clicktocall numberdata vsascentenhanceexecutive certificationtome and principesaudibest suitedrequired divuserproawsmpiccenterpradeshwestborderright1pxsocialinner ul litwitterselectvalindiamanagement machine learningadvanced financialimportant divuserpro857registerdiv userprofieldbillingstatetemp userprowarningremoveofferadmission0 socialinnercity statehondurashong konghungaryicelandindiaindonesiairanfrenchinputfocusoutlinenone important callmodalanalyst0 0 0guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarrunionromaniarussian1pxlogmayenswazilandswedenswitzerlandsyrian arab republictaiwanislandstuvaluugandaukraineunitedimportant paddingrgba0 0 0professional certificationopen technology ampintelligence and machinecunhasaint kittspasswordimguserproprofilebadgestatehondurashong konghungaryicelandindiaindonesiairan120px divuserpro655republicdenmarkdjiboutidominicadominicanpassword confirm passwordstrategymarketing xlri jamshedpurmarketing socialmarketingadmission open digitalricoqatarrunionromaniarussian federationrwandasaintopen advanced strategicamp kashmirjharkhandkarnatakakeralamadhyadivuserpro565 divuserproonlineitemdivuserpro471 divuserprouserofmoldova republiciiftentrepreneursadvisorpvt ltdmanagementprofessional certificate programuppercasesee vatican cityformer yugoslavguianafrench polynesiafrench southerngeneral managementcallmodal modalcontent clicktocalladmission open projectpartnersheight 50pxmodalcontent clicktocallkashmirjharkhandkarnatakakeralamadhya pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil nadutripurauttarakhanduttarcookiestripbarcontainersocialinner ulhr analyticsadmissionsocial networkfeesallahabad prayagrajpassword select countryafghanistanlandwidth 86px heightleonesingaporesint maarten dutchsales managementrepublicchadchilechinachristmasvs artificialtransformationamp public relationuserprofieldbillingstatetemp selectval registerdivtechnology leadershipadmission opendivemdfiltersopen business managementadmissionchain management projectbrand salesislandsnorwayomanpakistanpalaupalestinian territorypanamapapua newofmoldova republic ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnewalsoofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesiabrandmanaging brands marketingminor outlying islandsuruguayuzbekistanvanuatuvenezuelaborder1px solidequity researchdivoirecroatiacubacuraaocyprusczechhttpstalentedgecomwpadminadminajaxphp datauserprofieldbillingstatehide elsemaths phdmarketing analyticsthecook islandscostabilling first nameauserprouserimg span tophelp youdisplay nonepartsaintsales ampborderright1px ddd solidpositionabsolutecalltoactions afooterquicklinksactiondisplayinlineblockgsthighlight truechinatajikistantanzania unitedeustatiusul ligplusaccounting ampamp publicregisterdiv userprofieldbillingstatedisplayrohtakphone edit profilemathsemail password forgotifthisval registerdivleadership india valuelifacebookhuman120px divuserpro317beststrategic managementislandssouth sudanspainsri lankasudansurinamesvalbardverdecaymanprogrammalvinasfaroe islandsfijifinlandfrancefrench guianafrenchsababosniafunctionevent formid120px divuserpro163institutesmargin 0xlri faasee vaticannew guineaparaguayperuphilippinespitcairnpolandportugalpuertoiim kozhikode admissiondisplaynoneopacity 35s easeinoutsuccessmanisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic peoplestrendsmorebottom0technology leadershiptablemanagement projectbilling phone editlsbfmarketing digitalcaicos islandstuvaluugandaukraineunited arabprovince of chinatajikistantanzaniaautomarginright auto marginbottomindiafinance financialuswallisjamshedpur marketing strategyphonenumber password confirmsharmaadmission open humanbusiness analyticsimportant divuserpro163downpayment gstmaxwidthiiitglobaltable tdcomboright0margineustatius and sababosniaindian oceanfontsize 12px borderradiusauto marginbottom 30pxbilling state selectauserprouserimgdatapadding 5pxeaseinout transition opacitystrategiesislandsalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantiguahuman resource managementexecutivevs businessuserprofieldbillingstatetempshowthinkingmanagersadmission open machinegrenadinessamoasanlefttypenagardigital marketing coursedivuserprolistitemi width 50pxsolid d3d3d3management amp publicyugoslav republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall120px divuserpro317 divuserprousermscislandscentralbackamp leadership strategic5px 0selectval registerdivregisterdiv userprofieldbillingstatetempappendthisanalyticsmanagement leadershipthfinance brand salestransformrajatofvietmarketing trainingulafooterquicklinksactiondisplayinlineblockhelpsopen business managementmanagement machinevalue addstransformationadmissionrgba0iubh germany admissionadmission open businessyearu2019sinputwidth100displayblockheight36pxentrepreneurshipadmissionprincipesaudi arabiascotlandsenegalserbiaseychellessierra leonesingaporesintislandsfijifinlandfrancefrench guianafrench polynesiafrenchagreement registerdivrepublicchadchilechinachristmas islandcocos keelingfederated states ofmoldovadutch partslovakiasloveniasolomon999pximportant divuserpro979python excelregisterdiv userprofieldbillingstate inputvalsouth sandwich islandssouthautomationmarketing onlineprofbusiness managersoutlying islandsuruguayuzbekistanvanuatuvenezuela bolivarianislandnorthern marianaveryphd iimexecutiveprogram in businesssupply chainherzegovinabotswanabouvet islandbrazilbritish indianterritoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguineabissauguyanahaitihearddegreeantispam questionanswer480px marginleft automarginrightaccountfontfamily robotolucknow advanced programcertifiedanalytics vsluciasaint martin frenchborder1px dddrelationsclicktocallislandsholy seeexperience social networksoutherncorporaterelateddialogcontainerdivuserpro979vs digital8pxcareercity billingbangalore readimportant divuserpro814states minor outlyingnamvirgin islands0 auto widthagreementpradeshwest bengalandamanfasoburundicambodiacamerooncanadacape verdecaymanmepartslovakiasloveniasolomondivuserproawsmpic marginleft 48pxmaxheight 14px importantopen human capitalbrand sales ampnadutripurauttarakhanduttar pradeshwest bengalandamanaccounting auditing advancedimportant st1userprofieldbillingstateshow registerdivstatehondurashong konghungaryicelandindiaindonesiairan islamicemail designationaccountingmanagement executiveadmission open digitaldisplay flexofkorea05name billingdivuserpromsgoverlaycontent divuserpromsgoverlaycontent inputverdecayman islandscentral africanmanagementprofessionalkozhikodestrategy ampopen masters programdiscoverpicture full namefacultyentertainment managementopen hr analyticsmaxwidth 768pxconfirm password selectstate ofbonaire sintassessmentperformancemanagement technologyopen advertisingpgdforgot password usernamemarketing coursesdivuserpro979 divuserprouser auserprouserimgchain strategy managementregisterdiv userprofieldbillingstatehide elsesoftwareopen digital marketingopen advanced financialterritorybrunei darussalambulgariaburkinaul lipinterestadmission opendivuserprouserlinkgermanymanagementpg certificate programgeneral management iimmadefinancial risk managementpgc business120px divuserpro857 divuserprousercorporaterelateddialogwrapperhr managementborderlefthrthecook islandscosta ricactebankselectnevissaintmicaagreement registerdiv signupstatefieldsonchangefunctiondesign innovationlitwitteruserprofieldbillingcountry selectonchangefunction0bordertristan da cunhasaintterritoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguineabissauguyanahaitiheard islandmedia entertainmentfamiliarisation sessionspython knowledgeadmission openopen supply chaindivuserpro974 divuserprouserindustrialmanagementadmission open advancedpassword confirmtextarea divuserpronotifiernonemedia strategytransition allapipositionrelativename email addressfalsename emailauto marginbottomvisitorutmsourcecentersdivuserpro814 divuserprouser auserprouserimgcombo offeradmission openautofillhr analyticsadmission opendivuserpro select divuserprofield120px lineheight 120pxmarketing strategydata science120px height 120pxresources leadershipadmission openelse registerdivambaletterspacingnormal phonecallbottombarlearnmanagement admission openrojerscorporaterelateddialogwrapper corporaterelateddialogcontainer gformwrapperanalytics 1 yrstartplatformbrand managementoptionboxold pnthchildevenimportant alreadymanagement human resourceanalytics market researchfirst nameinstant callbackbengalandaman amppadding 10px 10pxborderleft 1pxchangeecornell admissionselect divuserprofieldmanagementpg certificateapikeypiftypeofinputvaldataemailaddressauto widthuserprofieldbillingstatetemp userprowarningremove registerdivanalyticsadmissionprincipesaudi arabiascotlandsenegalserbiaseychellessierrasupplyaccount signup backrolemarginleft automarginrightregisterdiv userprofieldbillingstateshow registerdivmanagement combo offercopal ambaanalytics onlinesupply chain strategyifregisterdiv userprofieldbillingcountry selectvalindiaend user agreementemiratesunited120px divuserpro974 divuserprouserdivuserpro input divuserprobilling citymanagement iim kozhikodemarginbottomlineheight 120pxzindex99 callmodal modalcontentsandwich islandssouthkashmirjharkhandkarnatakakeralamadhyawomenmcdonald islandsholy seeislandssouthsupportcallbackbuttontextfailedpeoples democratic republiclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedoniaregisterdiv userprofieldbillingstatetempshowselect countryafghanistanlandceopeoples republicclassroomsessionsmanagement humanexecutive coursesinput divuserpromsgoverlaycontent textareaanalytics 360admission openfnamecalltopimportant divuserpro655analytics priorsales marketingdutch partslovakiasloveniasolomon islandssomaliasouthofviet namvirgin islandsmanaging brandsposition relativeuserprofieldbillingstatetempshow registerdivofiraqirelandislemayenswazilandswedenswitzerlandsyrianselect divuserprofield textareauserproeditorscopeservicesmanagement iim lucknowbackgroundcolorlet0 paddingquestionscourse lsbfkingdomunited statesunited statesemi 0 0disastersolidpositionabsolutehave beenislandbrazilbritish indian2 important alreadynumber inputfocusoutlinenoneoptionboxoldglobal supplyprojectsandwich islandssouth sudanspainsriopen technology leadershipadmissionpierre and miquelonsaintread moreislands malvinasfaroest1auserprouserimg width 120pxname billing firstcertificate programbusiness administrationfasoburundicambodiacamerooncanadacape verdecayman islandscentraltermcursordivuserpro565allahabad0varrequired divuserproawsmpic marginleftecornell admission openislandnorthern mariana islandsnorwayomanpakistanpalaupalestinianmarketingreturnuserprobuttononclickfunction ifregisterdivcolorfff socialinner ulaccatrue mincharsdivuserpro655 divuserprouser auserprouserimgcertificationadmissionsgainrequiredseniorcasestateandhraluciasaint martin05s easedivuserproonlineitem imguserproprofilebadgeimg widthopen humanprocessing fees pfalignitemslast namemonthsricacte divoirecroatiacubacuraaocyprusczech republicdenmarkdjiboutidominicadominicanfirst name billingregisterdiv userprofieldbillingstatetemphidename billing lastisredirectdivuserprofieldfrench partsaint pierrewetransformationalsolidpositionabsolute zindex99 callmodaltop 120px lineheightopen hroverchinatajikistantanzania united republic3professionalinputvalthisval ifthisvalfamiliarisationinstantuserprofieldbillingstateshowbusiness analytics 1democratic peopleswidth 50px heightdourl httpstalentedgecomwpadminadminajaxphp dataamp marketing managingclosephd iim bangalorerisk managementadmissionstrategies for internationalreferred by profileutmsourceanalytics online certificationlet apikeyhavelidaman amp diudelhilakshadweeppuducherryopen machinedivuserproonlineitemi width 30pxgermany admission openemiheight 86pxrepublicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalklandamp supply chainbig data analyticsadmissionmanagement leadership changegreatkashmirjharkhandkarnatakakeralamadhya pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamilfutunawesterndownpayment dpmarketing micadegree coursesmanagement iim raipurmaartenpsexcel r xlriclose alreadymarginright 30pxmanagementadmissionanalyticsexecutive development programspan borderradius 999pxofthailandtimorlestetogotokelautongatrinidadbold corporaterelateddialogwrapperopen human resourcesall 05s easeknowledgeadmission openbrands marketingmaxheight 14pxinnovationadvanced strategic managementheightmarketing brand managementtristanfutunawestern saharayemenzambiazimbabwesoftware testing automationproject management projectchain strategybusiness administration iubhdivuserpro857 divuserprouseraddress phonenumber passwordextensionimportant maxheightdigital marketing micainputhoverwelladmission open technologypicturemanagement marketing120px divuserpro565islandsnorwayomanpakistanpalaupalestinian territorypanamapapuarepublic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesiabengalandaman amp nicobarchandigarhdadramanagement iimreasonspublic relationpierreedit profileampstudy humancapital leadershipwoulddivuserprouser divuserprouserlink widthselectval registerdiv userprofieldbillingstatekeeling islandscolombiacomoroscongocongoadmission open advertisingsignupblogdivuserpro471positionabsolute120px divuserpro974divuserprouser auserprouserimg spanhr management xlridigital marketing socialcolorfff1px solidopen industrial designislandentrepreneurshipadmission openxlri jamshedpur admissioncaledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthernhtml html htmlmaxwidth 250pxindia value addsadmissionrisk management iimimportant callmodalislandcocos keelingrohtak project managementalertresponsemanagement publicoptionspjimrbarbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanboliviamedia maxwidthdivuserpro655 divuserproonlineitembig databrowsemarketing analytics marketingltdcstcpiiit allahabadsamoaandorraangolaanguillaantarcticaantiguapublic relationsfull namemanagement certificatefaa registrationislandsnorwayomanpakistanpalaupalestinianfuturetextareaislandsalbaniaalgeriaamerican120px divuserpro814hr hrraipur admissionrepublic ofkuwaitkyrgyzstanlaoprofile picture fullindustry experiencegst loangst downpayment dpright managementgeorgiadata analyticsadmission openwidth 30px12px borderradiusethical hackingcurrentpagedivuserproawsmpic marginleftpolynesiafrench southernmodalcontent clicktocall lnamedivuserproonlineitemglobal supply chainamba financialstrategic human resourcestransformationadmission openadvancedhiddenmode true highlightmanagementadmission open technology120px heightyugoslavdemocratic peoples republicbusiness management micaimportant dont havecookiestripbar cookiestripbarcontainer8bangalore read moredivuserproonlineitem imguserproprofilebadgeright10px 10px48px divuserproawsmpic imgtalentend userwidth 86pxmaxwidth 100callbackdivuserpro655open appliedsaharayemenzambiazimbabwe billingmanagementexecutivedivuserpro163easeinout fontweighthuman capital0 0false supportcallbackbuttontextfailedfundsinputvalthisval ifthisval registerdivhavelidamannumberpeoples republic ofkoreaamp change managementimguserproprofilebadgeright maxwidth 14pxrepublic30px height 30pxmarginbottom 30pxdivemdmain divemdfilters divuserprosearchresults12px borderright1pxcapital leadershipadmissionpassword forgot passworduserprofieldbillingstatehide else registerdivinputhover callmodal modalcontentmanagementprofessional certificater k premarajansales amp marketingtransition opacity 35sfederated statescity statehondurashongcourse havemanagement comboprofile emailindian institute80px divemduser widthmarginleft 2open strategic leadershipadmission30px marginrightzindex99designationrecruiteruserprofieldbillingcountry selectonchangefunction registerdiv7c7c7c backgroundcolorpaddingsearchdivpgc business analytics0 fontsizeplanningverdecayman islandscentralplatform familiarisationmanagement micaleadership xlriautomarginright autodownpaymentul litwitteriimislands britishvirginthroughbilling city billingdivuserproawsmpic imghavedivemdfilters divuserprosearchresults divuserprolabelaccount signupsettimeoutfunctionrecoverybackgroundnoneborderradiusinternational coursesmasters programanalytics prior pythonpartslovakiasloveniasolomon islandssomaliasouth africasouthtrainingsocialpopupafter360admission open hradvertising management publicclicktocall lnamecity billing phoneprogram in digitalcolordata analyticsexecutivedivuserpro565 divuserprouser auserprouserimgahoverhr strategicregisterdiv userprofieldbillingcountrysocialinner ul lifacebookprogram feestechnology leadershipadmissionsuccess functionresponseislandbrazilbritishmanagement admissionleadership strategicdivoirecroatiacubacuraaocyprusczech republicdenmarkdjiboutidominicadominicanjustifycontentcenterdivuserpro textareaofkuwaitkyrgyzstanlao peoplesxlri jamshedpur hr48pxmanagers xlri jamshedpurconferencevsexecutive leadershipdivuserprolabel labelchange managementselectonchangefunction registerdivpositionfixedfunction35sbolivarian republic ofvietpgd in managementpeoplesstates ofmoldova republicresolutionsrepublic ofmadagascarmalawimalaysiamaldivesmalimaltamarshalltddivuserpro857 divuserproonlineitemdemocraticbrandsindustry experience socialanalytics marketing analyticsdivuserpro471 divuserprouser auserprouserimgcoursecolor 797979ligplusarab republictaiwan provincenoneborderradius 0marketing certificationknowselect stateandhrastrategic managementadmission openchain management supplydivuserprouser margintop 15pxvaluationfinance for businessislandstuvaluugandaukraineunited arabofiraqirelandisle of manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikoreaemiratesunited kingdomunitediim lucknow advanceddesignation industrylogisticsfontsize 13pxquestionanswer0 socialinner ulregisterdiv userprofieldbillingstatetempshow registerdivmanagement supplylinkedin emailamp salesarabiascotlandsenegalserbiaseychellessierra leonesingaporesint maartendivuserproprofileimg widthacca professionalusecampus mastersprior python knowledgeadmissionhttpsd37c7ubwjknfepcloudfrontnetwpcontentpluginsgravityformsimagesspinnergifborderbottomauserprouserimg span borderradiusanalytics data analyticsfinancial accountingmodalcontentmarketing and saleskingdomunited statesunitedtop 48pxauditing advanceddutchtextareauserproeditor divuserpromsgoverlaycontentaccounting auditingifthisvalindia registerdiv userprofieldbillingstatetempshowrepublic ofvietecommerce businessdigitalmanagementdarussalambulgariaburkinapradeshassambiharchhattisgarhgoagujaratharyanahimachal pradeshjammudivuserprolabel label divuserproopen strategicfunctioneventforgot password12managingkingdomunited0 0 optionuserprowarningremove registerdivknowledgeadmission30px heightxlriifthisval86px heightadvanced programanalytics 1findstateandhra pradesharunachal pradeshassambiharchhattisgarhgoagujaratharyanahimachalcorporaterelateddialogwrapper formblockanalytics admissionhasborder1pxbig data analyticsdivuserpro163 divuserprouserislandsmartiniquemauritaniamauritiusmayottemexicomicronesiariskrepublicecuadoregyptel salvadorequatorialnadutripurauttarakhanduttarahover i colorfffdivuserpropradeshassambiharchhattisgarhgoagujaratharyanahimachal pradeshjammu ampislandscentral african republicchadchilechinachristmaslnamerepublicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatoriallabel divuserproimportant divuserpro317120px divuserpro565 divuserprouseruserprofieldbillingstateshow registerdiv userprobuttononclickfunctionifthisvalindiazopimfunction17tobagotunisiaturkeyturkmenistanturksloanprogram in marketingfalguniconfirm password86px9important padding 10pxterritorypanamapapuadivuserprouser auserprouserimgvisitoremail3pxsamoaandorraangolaanguillaantarcticaantigua and barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanboliviaherzegovinabotswanabouvet islandbrazilbritishpointerrateboxreset passwordpf dppflearning vsanalytics xlriimguserproprofilebadgeright maxwidthchain mangement onlinerepublictaiwan provincefinance brandimportantresearch ampnagar havelidamanborderradiusartificialleonesingaporesint maartenjob linkedanalytics marketfontweight 600divemdfilters divuserprosearchresultssolid 7c7c7cpradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil nadutripurauttarakhanduttarcybermanagement businessfinancial managementsocialinneristbritishvirginsvgfill fffdivuserpro317 divuserprouserpost url httpstalentedgecomwpadminadminajaxphp12pxagreeleadershipadmissionul lifacebookguianafrench polynesiafrenchstrategichavelidaman ampdivuserprosearchresults divuserprolabel label50pxselectvalindia ifregisterdivislandssomaliasouth africasouth georgia15px marginleft 30pxdpmarketing online certificationelsecourses bestspan top 120pxselectrepublic ofkuwaitkyrgyzstanlao peoplesregisterdiv userprofieldbillingstatehidegrenadinessamoasan marinosao tomeinnovation and entrepreneurshipadmissionamp diudelhilakshadweeppuducherrysandwichonfailuredivuserproonlineitemiankitorganizationsresources managementmarketing social media768pxname last7statementnameinputvalthisvaldivuserprofield textareauserproeditor divuserpromsgoverlaycontentexperience socialleadership executive leadershipdevelopment programiubhpvtrepublic ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnewpradeshwest bengalandaman ampbrandingfees pf dppfcourse have beenislandstuvaluugandaukraineunited arab emiratesuniteddesignation industry experienceuserprofieldbillingstate inputvalthisval ifthisvaltranslate50 50statesupportcallbackbuttontextfailed clickcanstrategy iimbaloondivuserpro857 divuserprouser auserprouserimgstatesphonespan borderradiuspoppedwidth 30px heightstudy13iubh germanyislandsuruguayuzbekistanvanuatuvenezuela bolivarianofferpartslovakiasloveniasolomon islandssomaliasouthstrategic leadershipmanagement business managementcstcpiiit allahabad prayagrajsocialinner ul ligplusterritorypanamapapua new guineaparaguayperuphilippinespitcairnpolandportugalpuertotransformational leadershippaid4india valuemartin french partsaintcontactofthailandtimorlestetogotokelautongatrinidad and tobagotunisiaturkeyturkmenistanturksislandsuruguayuzbekistanvanuatuvenezuela bolivarian republicfalse supportcallbackbuttontextfailed clickbrands marketing communicationwidth 120pxsupply chain managementtexttransformwhymarketing coursecreateourleadership amp changegformwrapperpradeshjammu ampopen project managementleonesingaporesintleadershipadmission openpradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamilchain mangement80px divemduseraddsmarketing managingpnthchildeven widthkonghungaryicelandindiaindonesiairan islamic republicvs databritishvirgin islands uswallisconsolelogresponsemariana islandsnorwayomanpakistanpalaupalestinianuserprofieldbillingstatetempemail linkedinpositionmanagement certificationsocial network linkedinloginstrategic leadershipadmissionopen talentpeoples democraticmaxwidth 14px importantafrican republicchadchilechinachristmas islandcocosknow moremarketing strategy iimmanagement xlri jamshedpurnetwork linkedin checkview allfixeddivuserpro divemdmain divemdfiltersanalytics financialleadershipadmission open analyticssignupstatefieldsonchangefunction registerdivfinancial analyticsadmission openyearislandsmachine learningtobagotunisiaturkeyturkmenistanturks and caicosmanagement vshr strategic humankonghungaryicelandindiaindonesiairanfirstdivuserpro974 divuserprouser auserprouserimgdigital marketing onlineinputvalfontweightcorporaterelateddialogcontainer gformwrapper2 important dontrepublicecuadoregyptelmachine learning bigislandsfijifinlandfrancefrench guianafrenchjamshedpur data sciencepadding 10pxopen advancedminchars 3ofbonaire sintheight 30pxdivemduser widthcallmodal modalcontentlogin close16campus mbaofkorea republicnagar havelidaman amplabel divuserpro inputdigital transformationintopartnerloan amountf4f4f4pythontranslate50ajaxanalysisinputvaldataofaleadership ampsalvadorequatoriallinkedin email designationfontsize 14pxmasters of businessguptahas beenamp datamariana islandsnorwayomanpakistanpalaupalestinian territorypanamapapuaborderradius 999px importantregisterdiv userprofieldbillingstate inputvalthisvalmarketrepublic of thecookbusinessvisualizationcalltoactions afooterquicklinksactiondisplayinlineblock positionrelativevatican city statehondurashongrobotomarginleft 48pxoptionbox formcontrolapi calluserprofieldbillingstatehideterritorybrunei darussalambulgariaburkina fasoburundicambodiacamerooncanadacapeprayagraj admission openofkorea republic ofkuwaitkyrgyzstanlaostate ofbonaire0px important paddingdivuserpro textarea divuserpromartindivuserpro565 divuserprouser10px 0transition all 05sblockdivuserpro317 divuserprouser auserprouserimgkitts and nevissaintsouthcursor pointercheck i agreeamp nicobarchandigarhdadrawidth 100transitionmanagement combo offeradmissionhackingkonghungaryicelandindiaindonesiairan islamicmarketing vslinkedinworldreset password backsupply chain mangementmachinedivuserprofield textareauserproeditorchainkeyeasedont haveteamfinancial accounting ampresources leadershipadmissionaimadigital financeislandcocosfees pfpradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil nadutripurauttarakhanduttar pradeshwestplatform familiarisation sessionsleadershipselectonchangefunctionmanagementadmission openopen digital marketingadmissionstatesunited statesislandscolombiacomoroscongocongo the democraticislandsholy see vaticanislamicmedia marketingboldadvanced financial managementmanagement project managementphdbusiness managementnoaddress phonenumbermonths emimaarten dutchregisterdiv userprofieldbillingstateshowanalytics 360divuserpro814 divuserprouserdivuserpromsgoverlaycontent divuserpromsgoverlaycontentdivuserpro317flexbetween accountingsignupstatefieldsonchangefunctionadvanced strategicdivoirecroatiacubacuraaocyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptelemail address phonenumberindianprofile picturepremarajanlearning machineretrydivuserpromsgoverlaycontent inputjamshedpur dataphonenumber passwordprior python knowledgemangement onlinesouthern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguineabissauguyanahaitiheardbritishvirgin islandsresources managementadmission openmanagement coursevatican cityposttermsmanagementpgnew guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarrunionromaniarussian120px divuserpro814 divuserprouseramp entertainment mediaocean territorybrunei darussalambulgariaburkinaiim bangalore read100 importanttrueuswallis and futunawesternjqueryajax type postdivuserproonlineitem imguserproprofilebadgeright maxwidthexperienceinternationalislandscentral africaninstitute of technologyusing pythonuserprofieldbillingcountryecommerce business managementguineaeritreaestoniaethiopiafalkland islandsstrategic leadershipadmission openentertainment management micadigital marketing xlrijobselect countryafghanistanland islandsalbaniaalgeriaamericandivuserpro163 divuserproonlineitemrelationrgba0 0management iim rohtakinputvaldatafirstnameregisterdiv userprofieldbillingstatetemp selectvaldevelopmentusing python excelfrench partsaintmanisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikoreaguineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarrunionromaniarussian federationrwandasaintanalyticsexecutivemarketing analytics marketalreadypolynesiafrenchislandsfijifinlandfrancefrenchluciasaintdivuserpro divemdmainregisterdiv signupstatefieldsonchangefunctionheight 86px divuserprolearningcountryafghanistanlandavailablelogistics supplyregistrationimgdivuserprolistitemi widthmsc mathsseebarthlemysaint helenamarket researchcollege22 marginleft 2program in salesyour careerhuman capital leadershipadmissioncurrentiddivuserprouser divuserprouserlinkmaskbgshowborderradius5pxafricasouthpassword selectuserprofieldbillingcountry selectvalindiamanagementexecutive development programsupportcallbackbuttonpropdisabled false supportcallbackbuttontextfailedopen industrialmanagersdppf downpayment gstintelligenceplease enterlikeconfirmmedia amp entertainment0marketing brandhuman resources leadershipadmissionvaluer ktransition opacityprogram in managementadmissionpicture fullupcapitalvisualimguserproprofilebadgerightdata analytics 360admission05srisk managementtechnology ampfees with gstblockchain for seniorxlri jamshedpur marketingfinance10pxonlineproject management iimcopalopen pgc businessvalue addsadmissionplurinationaltextareauserproeditoruser agreement registerdivmaxwidth 100 importantaffiliatevisitorphoneamountmember5px padding 10pxanalytics datamalvinasfaroeamp diudelhilakshadweeppuducherry referredmonths program feesselectvalindia ifregisterdiv userprofieldbillingstatetempdarussalambulgariaburkina fasoburundicambodiacamerooncanadacapeknowledgeislands malvinasfaroe islandsfijifinlandfrancefrenchhelena ascensiondivuserpro selectbarbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanbolivia plurinationalascension and tristanstates minorspanheight36pxlineheight36pxpadding0 12px borderright1pxresources leadershiphighlight true minchars20pxjamshedpur hr managementstrategy managementlearning for managersreturn falseequitypolicymarginrightfaaexecutive leadership indiaemail addressmaxwidth 14pxrepublicchadchilechinachristmas islandcocosyrkeelinginputval ifthisvalindia registerdivmanagementexecutive certificateuserprofieldbillingstate inputvalprogram in managementloantypefirst name last22 marginleftcampuspassword backtesting automationjwmiposition absolute widthbusiness management projectprogram in leadership80pxjamshedpur iimislands uswallisdata analytics 360divuserpro471 divuserproonlineitemamp leadershipadmission open appliedreferredpictureupload12px borderradius 5pxusing excelsep20emi standardofbonaire sint eustatiusopen applied financialdivuserpromsgoverlaycontent textarea divuserpronotifiertechnology delhiislandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated statescaicosxlri jamshedpur dataoptionboxdigital marketingadmissiondr r kdata analyticsdivuserpro974selectval registerdiv userprofieldbillingstatetempappendthisterritorypanamapapua newemail passwordregisterdiv signupstatefieldsonchangefunction registerdivproject managementadmissionwidthleft50profile email linkedinback to loginxlri jamshedpuropen technologysuitedchinatajikistantanzania5000 returnuserprofieldbillingstatetemphidemore drtype post urlrajat sharmawidth 80px divemduserrepublic ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew caledonianewstrategic performanceinputwidth100displayblockheight36px border1pxcheck120px divuserpro163 divuserprousermaxwidth 480pxfull name billinglucknow marketing0 optionfinancial analyticsadmissionmanagement marketing analyticsmalvinasfaroe islandsfijifinlandfrancefrenchtop50pradeshjammuofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federatedmanagementadmission open humanadmissions openmaths phd iimsocial media30px marginright 30pxricacte divoirecroatiacubacuraaocyprusczechmachine learning machineusernamedarussalambulgariaburkina fasoburundicambodiacamerooncanadacape verdecaymanmcdonald islandsholyfulloutlyingprofessional courseauserprouserimg widthpadding10pxmonths emi 06opacitymember first namer xlrimedia amphave been scheduledpriormarketing xlribilling phonemarketingadmissionguineaparaguayperuphilippinespitcairnpolandportugalpuertoamp leadership executivelastreseteminent facultyscreenboxshadowmarinosaoifregisterdiv userprofieldbillingcountryanalytics xlri jamshedpuruserprowarningremovefederationrwandasaint barthlemysaint helenamarketing trendspython knowledgeadmissionurl httpstalentedgecomwpadminadminajaxphpmastersadmission open strategicfff important st1dppfdivuserprolistitemidocumentreadyfunctionoffproject managementadmission openactionpartsaint pierrewidth 22opacity 35sjamshedpurmarginleft automarginright autopradeshjammu amp kashmirjharkhandkarnatakakeralamadhyaborderright1px dddsolidareaformer yugoslav republicindian ocean territorybruneiislamic republicmanagement supply chainapplied financiallearning bigbengalandamanfasoburundicambodiacamerooncanadacapepleasedivuserpro163 divuserprouser auserprouserimgddd1timeamp entertainmentucla extensiondivemduser width 22prior python360admissionconfirmationcontentstartupskozhikode admission openborder 1pxbarbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanbolivia plurinational statedata analytics prior1 yrmanagement globalpolynesiafrench southern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguineabissauguyanahaitiheardsolid 7c7c7c backgroundcolorpmonline executiveafrican republicchadchilechinachristmasskills coursefontsize 16pxdemocratic republicborder 0tristan daofkuwaitkyrgyzstanlaobatchdata actionscienceentertainmentcallmodaladmission open industrialopen ecommercecontentsababosnia and herzegovinabotswanabouvetfadiaskillsdr rojersuserprowarningremove registerdiv userprofieldbillingcountrynetworkheight 120pxrohtak iimmarketing managing brandsscheduledislandscosta ricacteopen projectminor outlyingemail designation industrymasterdesigndivemdmain0 05standardcombo offeradmissionanalytics spjimrlabelmobilecolor fffarabiascotlandsenegalserbiaseychellessierraherzegovinabotswanabouvethiddenmode true14px important maxheightregisterdiv userprobuttononclickfunctionsvgfill fff importanttrue highlightborderprayagrajdivuserpronotifier fontfamily robototechnologypfresource managementexecutivebilling firstscience usingclose resetifregisterdiv userprofieldbillingstatetemp selectvalofbonaireregisterdiv userprobuttononclickfunction ifregisterdivcertified cyberhuman resources leadershipwidth 120px heightdigital transformationadmissionofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew caledonianewislandscostauserprofieldbillingstate inputvalthisvaloutlying islandsuruguayuzbekistanvanuatuvenezuelaunited republic ofthailandtimorlestetogotokelautongatrinidaddemocratic republiclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedoniadivemdmain divemdfiltersemiratesunited kingdomunited statesunited13pxspanheight36pxlineheight36pxpadding0 12pxmarketing professionallinkedfinancial analyticstextalignhelpjob linked programsalignitemscentervarhtml htmladministration iubh250pxfff importantlinkedin checklogin usernameinstituteiiit bangalorealready havephonecallbottombarmanagement hrtalentedgemayenswazilandswedenswitzerlandsyrian arabmanagement onlinestepmanagersadmission openregisterdiv userprofieldbillingstatetempappendthis fieldantispam16pxcorporaterelateddialogwrapper corporaterelateddialogcontainerhuman resources managementadmissionaccount loginmargintop 15pxrohtak projectinternational businessexcelzealandnicaraguanigernigerianiuenorfolkopen machine learningtransparentascensioniim raipur admissionrepubliclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedoniaformiduserprobuttononclickfunction ifregisterdiv userprofieldbillingcountryeaseinoutifthisvalindia registerdivartificial intelligencemiquelonsaint2 importantbold corporaterelateddialogwrapper formblock2type postdivuserpro857allahabad prayagraj admissionlankasudansurinamesvalbardprivacyadmission open talentddd solidpositionabsolutesint eustatiuslineheightdppf downpaymentclose reset passwordelse registerdiv userprofieldbillingstatetemphidenetwork linkedinplurinational statetextarea divuserpro selectamp kashmirjharkhandkarnatakakeralamadhya pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamilleadership xlri jamshedpurricacteprofessoradmission open advancedjqueryajaxsodivuserpro979 divuserproonlineitem14pxleadership changeguianafrenchxlri faa registrationdivuserprosearchresults divuserprolabelregisterdiv userprofieldbillingstatetempeducationname last nameraipur admission openalready a memberarabiascotlandsenegalserbiaseychellessierra leonesingaporesintidstrategic performance managementddd solidpositionabsolute zindex99business managementadmissioncompanyhelenanamvirgincampus masters program360admission openprogram in financialsupportcallbackbuttonpropdisabledislandsmartiniquemauritaniamauritiusmayottemexicomicronesia federatedclickdisplayflexfontsizeacademic partnerszealandnicaraguanigernigerianiuenorfolk islandnorthern marianathecookspanheight36pxlineheight36pxpadding0emailsouthern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguineabissauguyanahaitiheard islanddivuserpro974 divuserproonlineitemrepublic ofthailandtimorlestetogotokelautongatrinidad999px importantfinancial risk50px height 50pxarab emiratesunited kingdomunitedleadershipadmission open strategic86px divuserpro divemdmaindriim rohtak projectbeginnersurlopen executive leadership15jamshedpur marketingmanisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democraticprogram in strategicmanagement xlrisignup backsoftware testingdata analyticsadmissionislandcocos keeling islandscolombiacomoroscongocongo35s easeinoutdivuserpro655 divuserprouserautomarginrightdivuserpro979 divuserprouserhighlight0boxshadow noneborderradius 0coursesamp it digitalislandscosta ricacte divoirecroatiacubacuraaocyprusczechprovincedp processing feesjan mayenswazilandswedenswitzerlandsyrian30pxclick to retryoceanbasic7c7c7cborderleft 1px soliddivuserproawsmpic img widthoptionbox tablenumber inputfocusoutlinenone importantscience using pythonscience online certificationpassword divuserproawsmpicmarketingadmission openformblockdata science usingmyemail antispamuserprofieldbillingcountry selectvalindia ifregisterdivrisk managementadmission openopen analyticskittsrepubliclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedonia the formerindustrial designchoose11browse coursesafricasouth georgia0 optionboxfield is requiredstrategic managementadmissionkdivuserprosearchresultsdivuserpro317 divuserproonlineitemjamshedpur hrreadfontweight bold corporaterelateddialogwrapperbilling statenoneborderradius 0 socialinnerunited republichandlevisitorutmtermtable thmanagersadmissionseoifuser agreementprocessing feestrue highlight true

Longtail Keyword Density for Talentedge.in

KeywordsOccurences
management xlri jamshedpur24
callmodal modal-content click-to-call20
supply chain management20
big data analytics19
divuserpro-user auserpro-user-img span18
jamshedpur admission open18
xlri jamshedpur admission18
open machine learning17
machine learning big17
learning big data17
applied financial risk16
program in leadership15
ecornell admission open14
html html html13
financial risk management13
management admission open12
management iim kozhikode12
industrial design innovation12
program in management12
management project management11
strategy amp leadership11
management iim raipur10
open applied financial10
strategic management iim10
0 0 010
padding 10px 010
sales amp marketing10
divuserpro-user divuserpro-user-link width9
divuserpro-user-link width 120px9
auserpro-user-img span border-radius9
margin-left 2 important9
-120px line-height 120px9
have an account9
top -120px line-height9
border 1px solid9
span top -120px9
auserpro-user-img span top9
width 120px height9
auserpro-user-img width 120px9
management iim rohtak9
divuserpro-user auserpro-user-img width9
30px margin-right 30px9
margin-left 30px margin-right9
120px height 120px9
divuserpro-profile-img width 80px9
22 margin-left 29
border-radius 999px important9
important padding 10px9
divuserpro-online-item border-bottom 0px9
data science using9
30px height 30px9
width 30px height9
divuserpro-online-item-i width 30px9
50px height 50px9
width 50px height9
divuserpro-list-item-i width 50px9
10px 0 09
divuserpro-online-item imguserpro-profile-badge-right max-width9
width 22 margin-left9
imguserpro-profile-badge-right max-width 14px9
max-width 14px important9
span border-radius 999px9
14px important max-height9
important max-height 14px9
max-height 14px important9
margin-top 15px margin-left9
human resource management9
width 80px divemd-user9
80px divemd-user width9
divemd-user width 229
15px margin-left 30px9
automargin-right auto margin-bottom9
0px important padding9
divuserpro divemd-main divemd-filters9
divuserpro select divuserpro-field9
textarea divuserpro select9
divuserpro textarea divuserpro9
input divuserpro textarea9
divuserpro input divuserpro9
label divuserpro input9
divuserpro-label label divuserpro9
divuserpro-search-results divuserpro-label label9
divemd-filters divuserpro-search-results divuserpro-label9
divemd-main divemd-filters divuserpro-search-results9
86px divuserpro divemd-main9
select divuserpro-field textareauserproeditor9
height 86px divuserpro9
86px height 86px9
width 86px height9
img width 86px9
divuserpro-awsm-pic img width9
-48px divuserpro-awsm-pic img9
top -48px divuserpro-awsm-pic9
-48px top -48px9
margin-left -48px top9
divuserpro-awsm-pic margin-left -48px9
divuserpro-user margin-top 15px9
1px solid d3d3d39
leadership strategic management9
textarea divuserpro-notifier font-family9
fff important st-19
strategic human resources9
max-width 100 important9
auto margin-bottom 30px9
border-bottom 0px important9
margin-left automargin-right auto9
480px margin-left automargin-right9
max-width 480px margin-left9
divuserpro-notifier font-family roboto9
master of business9
divuserpro-msg-overlay-content textarea divuserpro-notifier9
divuserpro-msg-overlay-content input divuserpro-msg-overlay-content9
divuserpro-field textareauserproeditor divuserpro-msg-overlay-content9
textareauserproeditor divuserpro-msg-overlay-content divuserpro-msg-overlay-content9
divuserpro-msg-overlay-content divuserpro-msg-overlay-content input9
input divuserpro-msg-overlay-content textarea9
opacity 35s ease-in-out8
leadership india value8
media entertainment management8
open human capital8
digital marketingadmission open8
financial accounting auditing8
data analytics prior8
admission open business8
analytics marketing analytics8
mica admission open8
analytics prior python8
supply chain strategy8
executive leadership india7
blockchain for senior7
pgc business analytics7
advertising management public7
open masters program7
project management iim7
program in digital7
managementexecutive development program7
managementexecutive certificate program7
managing brands marketing7
open industrial design7
admission open digital7
admission open machine7
business analytics 17
open digital marketing7
program in business7
intelligence and machine7
research and data7
social media strategy7
admission open applied6
program in marketing6
mba from ascent6
open supply chain6
iim kozhikode admission6
open business management6
digital marketing mica6
leadership ecornell admission6
userpro-field-billingstatetemp selectval registerdiv6
raipur admission open6
iim raipur admission6
kozhikode admission open6
admission open human6
human capital leadership6
admission open strategic6
modal-content click-to-call number6
analytics xlri jamshedpur6
iim rohtak iim6
global supply chain6
leadership change management6
open digital marketingadmission6
iim lucknow advanced6
management iim lucknow6
rohtak iim rohtak6
marketing analytics marketing6
r xlri jamshedpur6
excel r xlri6
innovation and entrepreneurshipadmission6
back to login6
brand sales amp6
management business management6
strategic performance management6
marketing strategy iim6
marketing online certification6
strategy iim lucknow6
digital marketing social6
marketing social media6
program in strategic6
lucknow advanced program6
url httpstalentedgecomwp-adminadmin-ajaxphp data5
open pgc business5
margin 0 auto5
type post url5
management public relations5
open advertising management5
cstcp-iiit allahabad prayagraj5
brands marketing communication5
jamshedpur data science5
jqueryajax type post5
xlri jamshedpur data5
analytics admission open5
masters of business5
program in financial5
rgba0 0 05
science using python5
0box-shadow noneborder-radius 05
analytics 1 yr5
technology leadershipadmission open5
marketing and sales5
strategies for international5
finance for business5
2 important dont5
important dont have5
digital marketing digital5
media amp entertainment5
open project management5
leadership executive leadership5
svgfill fff important5
httpstalentedgecomwp-adminadmin-ajaxphp data action5
human resources leadershipadmission5
resources leadershipadmission open5
open technology leadershipadmission5
chain strategy management5
colorfff social-inner ul5
advanced strategic management5
phd iim bangalore5
innovation and entrepreneurship5
0border 0box-shadow noneborder-radius5
0 social-inner ul5
maths phd iim5
msc maths phd5
open advanced strategic5
open human resources5
admission open advanced5
learning for managers5
digital marketing course5
ahover i colorfff5
noneborder-radius 0 social-inner5
divuserpro-471 divuserpro-user auserpro-user-img4
corporate-related-dialog-wrapper corporate-related-dialog-container gformwrapper4
35s ease-in-out transition4
transform translate-50 -504
trends in marketing4
divuserpro-317 divuserpro-user auserpro-user-img4
digital marketing online4
divuserpro-163 divuserpro-user auserpro-user-img4
amp change management4
amp supply chain4
leadership amp change4
first name last4
name last name4
prayagraj admission open4
management combo offer4
ease-in-out transition opacity4
management marketing analytics4
ecommerce business management4
pgd in management4
financial analyticsadmission open4
financial risk managementadmission4
risk managementadmission open4
managementadmission open advanced4
open advanced financial4
acca skills course4
acca professional course4
xlri faa registration4
accounting auditing advanced4
marketing brand management4
sales marketing management4
business managementadmission open4
marketing analytics market4
analytics market research4
hr analyticsadmission open4
using python excel4
python excel r4
strategic managementadmission open4
managementadmission open human4
human capital leadershipadmission4
capital leadershipadmission open4
transition opacity 35s4
dp processing fees4
downpayment dp processing4
open ecommerce business4
open business managementadmission4
strategic management hr4
emi 0 04
chain management project4
off campus masters4
campus masters program4
program in managementadmission4
managementadmission open masters4
management combo offeradmission4
combo offeradmission open4
divuserpro-565 divuserpro-user auserpro-user-img4
divuserpro-655 divuserpro-user auserpro-user-img4
admission open hr4
margin 0 padding4
divuserpro-979 divuserpro-user auserpro-user-img4
open technology amp4
managementadmission open business4
months emi 04
amount with gst4
admission open supply4
chain management supply4
management supply chain4
gst loan amount4
downpayment gst loan4
project management project4
dppf downpayment gst4
pf dppf downpayment4
fees pf dppf4
management project managementadmission4
project managementadmission open4
management leadership change4
processing fees pf4
management human resource4
germany admission open4
advanced financial management4
risk management iim4
business management mica4
learning for managersadmission4
open executive leadership4
talent management xlri4
allahabad prayagraj admission4
divuserpro-857 divuserpro-user auserpro-user-img4
iim bangalore read4
business administration iubh4
administration iubh germany4
iubh germany admission4
leadership xlri jamshedpur4
human resources management4
digital marketing xlri4
marketing xlri jamshedpur4
managers xlri jamshedpur4
bangalore read more4
copal amba financial4
entertainment management mica4
0 0 054
ease-in-out font-weight bold4
35s ease-in-out font-weight4
general management iim4
xlri jamshedpur marketing4
jamshedpur marketing strategy4
prior python knowledge4
admission open executive4
human resources leadership4
entrepreneurship iim rohtak4
managersadmission open machine4
big data analyticsadmission4
data analyticsadmission open4
prior python knowledgeadmission4
python knowledgeadmission open4
certified cyber warrior4
logistics supply chain4
gst downpayment dp4
fees with gst4
marketingadmission open digital4
data analytics 3604
hr management xlri4
months program fees4
amp public relation4
india value adds4
science using excel4
using excel r4
divuserpro-974 divuserpro-user auserpro-user-img4
management machine learning4
open strategic human4
border-right1px ddd solidpositionabsolute4
12px border-right1px ddd4
divuserpro-814 divuserpro-user auserpro-user-img4
field is required3
ifregisterdiv userpro-field-billingcountry selectvalindia3
2 important already3
important already have3
registerdiv userpro-buttononclickfunction ifregisterdiv3
userpro-buttononclickfunction ifregisterdiv userpro-field-billingcountry3
required divuserpro-awsm-pic margin-left3
userpro-field-billingcountry selectvalindia ifregisterdiv3
120px divuserpro-317 divuserpro-user3
120px divuserpro-814 divuserpro-user3
registerdiv userpro-field-billingstatetempappendthis field3
selectvalindia ifregisterdiv userpro-field-billingstatetemp3
courses best suited3
120px divuserpro-974 divuserpro-user3
ifregisterdiv userpro-field-billingstatetemp selectval3
selectval registerdiv userpro-field-billingstatetempappendthis3
userpro-field-billingstateshow registerdiv userpro-buttononclickfunction3
job linked programs3
registerdiv userpro-field-billingstateshow registerdiv3
email linkedin email3
end user agreement3
check i agree3
network linkedin check3
social network linkedin3
experience social network3
industry experience social3
designation industry experience3
email designation industry3
linkedin email designation3
profile email linkedin3
agreement registerdiv signupstatefieldsonchangefunction3
edit profile email3
phone edit profile3
billing phone edit3
city billing phone3
billing city billing3
name billing city3
last name billing3
billing last name3
name billing last3
first name billing3
user agreement registerdiv3
registerdiv signupstatefieldsonchangefunction registerdiv3
userpro-field-billingstatetemphide registerdiv userpro-field-billingstateshow3
selectval registerdiv userpro-field-billingstate3
registerdiv userpro-field-billingstatetemphide registerdiv3
else registerdiv userpro-field-billingstatetemphide3
userpro-field-billingstatehide else registerdiv3
registerdiv userpro-field-billingstatehide else3
userpro-field-billingstatetempshow registerdiv userpro-field-billingstatehide3
registerdiv userpro-field-billingstatetempshow registerdiv3
ifthisvalindia registerdiv userpro-field-billingstatetempshow3
inputval ifthisvalindia registerdiv3
userpro-field-billingstate inputval ifthisvalindia3
registerdiv userpro-field-billingstate inputval3
registerdiv userpro-field-billingstatetemp selectval3
signupstatefieldsonchangefunction registerdiv userpro-field-billingstate3
selectonchangefunction registerdiv userpro-field-billingstatetemp3
userpro-field-billingcountry selectonchangefunction registerdiv3
registerdiv userpro-field-billingcountry selectonchangefunction3
userpro-warningremove registerdiv userpro-field-billingcountry3
userpro-field-billingstatetemp userpro-warningremove registerdiv3
registerdiv userpro-field-billingstatetemp userpro-warningremove3
ifthisval registerdiv userpro-field-billingstatetemp3
inputvalthisval ifthisval registerdiv3
userpro-field-billingstate inputvalthisval ifthisval3
registerdiv userpro-field-billingstate inputvalthisval3
120px divuserpro-655 divuserpro-user3
all 05s ease3
120px divuserpro-857 divuserpro-user3
transition all 05s3
false supportcallbackbuttontextfailed click3
supportcallbackbuttonpropdisabled false supportcallbackbuttontextfailed3
5000 return else3
bold corporate-related-dialog-wrapper form-block3
font-weight bold corporate-related-dialog-wrapper3
name billing first3
solid 7c7c7c background-color3
inputwidth100displayblockheight36px border1px ddd3
padding 10px 10px3
5px padding 10px3
border-radius 5px padding3
12px border-radius 5px3
font-size 12px border-radius3
social-inner ul litwitter3
click to retry3
inputhover callmodal modal-content3
social-inner ul lilinkedin3
0 0 option3
option-box table td3
option-box table th3
border-left 1px solid3
option-boxold pnth-childeven width3
emi standard emi3
standard emi standard3
modal-content click-to-call lname3
click-to-call number inputfocusoutlinenone3
z-index99 callmodal modal-content3
solidpositionabsolute z-index99 callmodal3
ddd solidpositionabsolute z-index993
spanheight36pxline-height36pxpadding0 12px border-right1px3
important callmodal modal-content3
inputfocusoutlinenone important callmodal3
number inputfocusoutlinenone important3
social-inner ul lipinterest3
social-inner ul ligplus3
120px divuserpro-565 divuserpro-user3
read more dr3
managementprofessional certificate program3
analyticsexecutive development program3
managementpg certificate program3
program in machine3
calltoactions afooter-quick-links-actiondisplayinline-block positionrelative3
position absolute width3
r k premarajan3
program in human3
dr r k3
have been scheduled3
course have been3
platform familiarisation sessions3
120px divuserpro-979 divuserpro-user3
0 auto width3
program in project3
human resource managementexecutive3
social-inner ul lifacebook3
chain mangement online3
post url httpstalentedgecomwp-adminadmin-ajaxphp3
true minchars 33
highlight true minchars3
true highlight true3
hiddenmode true highlight3
amp marketing management3
supply chain mangement3
program in sales3
science online certification3
marketing vs digital3
learning in data3
analytics online certification3
management amp public3
marketing professional certification3
financial accounting amp3
billing first name3
samoaandorraangolaanguillaantarcticaantigua and barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanbolivia3
full name billing3
confirm password select3
sababosnia and herzegovinabotswanabouvet3
eustatius and sababosnia3
ofbonaire sint eustatius3
state ofbonaire sint3
plurinational state ofbonaire3
barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanbolivia plurinational state3
finance brand sales3
countryafghanistanland islandsalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua3
select countryafghanistanland islandsalbaniaalgeriaamerican3
password select countryafghanistanland3
password confirm password3
islandbrazilbritish indian ocean3
phonenumber password confirm3
address phonenumber password3
e-mail address phonenumber3
name e-mail address3
last name e-mail3
member first name3
already a member3
account signup back3
120px divuserpro-471 divuserpro-user3
email antispam questionanswer3
username or email3
herzegovinabotswanabouvet islandbrazilbritish indian3
indian ocean territorybrunei3
close reset password3
ricacte divoirecroatiacubacuraaocyprusczech republicdenmarkdjiboutidominicadominican3
polynesiafrench southern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitiheard3
guianafrench polynesiafrench southern3
islandsfijifinlandfrancefrench guianafrench polynesiafrench3
malvinasfaroe islandsfijifinlandfrancefrench guianafrench3
islands malvinasfaroe islandsfijifinlandfrancefrench3
guineaeritreaestoniaethiopiafalkland islands malvinasfaroe3
salvadorequatorial guineaeritreaestoniaethiopiafalkland islands3
republicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland3
republicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatorial3
divoirecroatiacubacuraaocyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptel3
islandscosta ricacte divoirecroatiacubacuraaocyprusczech3
ocean territorybrunei darussalambulgariaburkina3
thecook islandscosta ricacte3
republic of thecook3
islandscolombiacomoroscongocongo the democratic3
islandcocos keeling islandscolombiacomoroscongocongo3
republicchadchilechinachristmas islandcocos keeling3
african republicchadchilechinachristmas islandcocos3
islandscentral african republicchadchilechinachristmas3
verdecayman islandscentral african3
fasoburundicambodiacamerooncanadacape verdecayman islandscentral3
darussalambulgariaburkina fasoburundicambodiacamerooncanadacape verdecayman3
territorybrunei darussalambulgariaburkina fasoburundicambodiacamerooncanadacape3
reset password back3
120px divuserpro-163 divuserpro-user3
island and mcdonald3
chain management global3
marketing digital marketing3
learning machine learning3
machine learning machine3
strategic leadershipadmission open3
open strategic leadershipadmission3
leadershipadmission open strategic3
rohtak project management3
iim rohtak project3
admission open project3
management global supply3
admission open industrial3
amp leadership executive3
amp it machine3
admission open technology3
open talent management3
admission open talent3
amp leadership strategic3
admission open pgc3
open hr analytics3
admission open advertising3
marketing managing brands3
amp marketing managing3
business management project3
amp entertainment media3
india value addsadmission3
password divuserpro-awsm-pic margin-left3
institute of technology3
forgot password divuserpro-awsm-pic3
password forgot password3
e-mail password forgot3
username or e-mail3
forgot password username3
xlri jamshedpur iim3
jamshedpur hr management3
xlri jamshedpur hr3
iim lucknow marketing3
conference on assessment3
software testing automation3
digital transformationadmission open3
value addsadmission open3
amp it digital3
managementadmission open technology3
resources managementadmission open3
human resources managementadmission3
leadershipadmission open human3
hr strategic human3
360admission open hr3
analytics 360admission open3
data analytics 360admission3
analytics data analytics3
leadershipadmission open analytics3
southern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitiheard island3
mcdonald islandsholy see3
picture full name3
caicos islandstuvaluugandaukraineunited arab3
bolivarian republic ofviet3
islandsuruguayuzbekistanvanuatuvenezuela bolivarian republic3
outlying islandsuruguayuzbekistanvanuatuvenezuela bolivarian3
minor outlying islandsuruguayuzbekistanvanuatuvenezuela3
states minor outlying3
statesunited states minor3
kingdomunited statesunited states3
emiratesunited kingdomunited statesunited3
arab emiratesunited kingdomunited3
islandstuvaluugandaukraineunited arab emiratesunited3
tobagotunisiaturkeyturkmenistanturks and caicos3
ofviet namvirgin islands3
ofthailandtimor-lestetogotokelautongatrinidad and tobagotunisiaturkeyturkmenistanturks3
united republic ofthailandtimor-lestetogotokelautongatrinidad3
chinatajikistantanzania united republic3
province of chinatajikistantanzania3
arab republictaiwan province3
mayenswazilandswedenswitzerlandsyrian arab republictaiwan3
jan mayenswazilandswedenswitzerlandsyrian arab3
lankasudansurinamesvalbard and jan3
islandssouth sudanspainsri lankasudansurinamesvalbard3
sandwich islandssouth sudanspainsri3
south sandwich islandssouth3
republic ofviet namvirgin3
namvirgin islands britishvirgin3
partslovakiasloveniasolomon islandssomaliasouth africasouth3
kashmirjharkhandkarnatakakeralamadhya pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil nadutripurauttarakhanduttar3
profile picture full3
pictureupload a profile3
referred by profile3
amp diudelhilakshadweeppuducherry referred3
havelidaman amp diudelhilakshadweeppuducherry3
nagar havelidaman amp3
nicobarchandigarhdadra and nagar3
bengalandaman amp nicobarchandigarhdadra3
pradeshwest bengalandaman amp3
nadutripurauttarakhanduttar pradeshwest bengalandaman3
pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil nadutripurauttarakhanduttar pradeshwest3
amp kashmirjharkhandkarnatakakeralamadhya pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil3
islands britishvirgin islands3
pradeshjammu amp kashmirjharkhandkarnatakakeralamadhya3
pradeshassambiharchhattisgarhgoagujaratharyanahimachal pradeshjammu amp3
pradesharunachal pradeshassambiharchhattisgarhgoagujaratharyanahimachal pradeshjammu3
state---andhra pradesharunachal pradeshassambiharchhattisgarhgoagujaratharyanahimachal3
---select state---andhra pradesharunachal3
state ---select state---andhra3
billing state ---select3
saharayemenzambiazimbabwe billing state3
futunawestern saharayemenzambiazimbabwe billing3
uswallis and futunawestern3
britishvirgin islands uswallis3
islandssomaliasouth africasouth georgia3
dutch partslovakiasloveniasolomon islandssomaliasouth3
islandsholy see vatican3
republic ofkuwaitkyrgyzstanlao peoples3
states ofmoldova republic3
federated states ofmoldova3
islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states3
ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated3
republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia3
yugoslav republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall3
former yugoslav republic3
republiclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedonia the former3
peoples democratic republiclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedonia3
ofkuwaitkyrgyzstanlao peoples democratic3
ofkorea republic ofkuwaitkyrgyzstanlao3
republic ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew caledonianew3
republic ofkorea republic3
peoples republic ofkorea3
democratic peoples republic3
manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic peoples3
ofiraqirelandisle of manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea3
islamic republic ofiraqirelandisle3
konghungaryicelandindiaindonesiairan islamic republic3
statehondurashong konghungaryicelandindiaindonesiairan islamic3
city statehondurashong konghungaryicelandindiaindonesiairan3
vatican city statehondurashong3
see vatican city3
ofmoldova republic ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew3
ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew caledonianew zealandnicaraguanigernigerianiuenorfolk3
maarten dutch partslovakiasloveniasolomon3
da cunhasaint kitts3
leonesingaporesint maarten dutch3
arabiascotlandsenegalserbiaseychellessierra leonesingaporesint maarten3
principesaudi arabiascotlandsenegalserbiaseychellessierra leonesingaporesint3
tome and principesaudi3
grenadinessamoasan marinosao tome3
pierre and miquelonsaint3
french partsaint pierre3
martin french partsaint3
luciasaint martin french3
nevissaint luciasaint martin3
kitts and nevissaint3
tristan da cunhasaint3
caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern3
ascension and tristan3
barthlemysaint helena ascension3
federationrwandasaint barthlemysaint helena3
ricoqatarrunionromaniarussian federationrwandasaint barthlemysaint3
guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarrunionromaniarussian federationrwandasaint3
new guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarrunionromaniarussian3
territorypanamapapua new guineaparaguayperuphilippinespitcairnpolandportugalpuerto3
islandsnorwayomanpakistanpalaupalestinian territorypanamapapua new3
mariana islandsnorwayomanpakistanpalaupalestinian territorypanamapapua3
islandnorthern mariana islandsnorwayomanpakistanpalaupalestinian3
zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana3
screen and max-width3
admission open93
digital marketing85
xlri jamshedpur57
supply chain45
machine learning42
data analytics38
certificate program38
management iim37
big data36
divuserpro-user auserpro-user-img36
0 032
strategic management29
managementadmission open29
project management28
management xlri24
chain management23
development program23
financial risk23
callmodal modal-content23
business management23
online certification22
important st-120
modal-content click-to-call20
marketing analytics20
iim rohtak20
leadershipadmission open19
social-inner ul19
iim lucknow19
14px important18
human resource18
jamshedpur admission18
risk management18
auserpro-user-img span18
width 120px18
marketing online17
padding 10px17
human resources17
masters program17
open machine17
iim raipur17
learning big17
data science16
marketing course16
applied financial16
amp marketing16
sales amp16
business analytics15
open digital15
management project15
iim kozhikode15
1px solid14
analyticsadmission open14
option-box table14
ecornell admission14
open business14
html html14
leadership strategic13
talent management13
open human13
business administration13
change management12
financial management12
design innovation12
industrial design12
strategy amp12
width 10012
management admission12
margin 012
corporate-related-dialog-wrapper corporate-related-dialog-container12
human capital12
marketing strategy12
advanced program11
open technology11
open hr11
amp leadership11
executive leadership11
financial accounting11
open strategic11
hr management11
margin-top 15px10
general management10
resource management10
social media10
technology amp10
fff important10
open applied10
open masters10
management mica10
10px 010
divuserpro input9
marketing vs9
divuserpro-label label9
label divuserpro9
divuserpro textarea9
input divuserpro9
divuserpro-search-results divuserpro-label9
textarea divuserpro9
divuserpro-msg-overlay-content divuserpro-msg-overlay-content9
divuserpro select9
select divuserpro-field9
divuserpro-field textareauserproeditor9
-48px top9
divemd-filters divuserpro-search-results9
top -48px9
width 86px9
-48px divuserpro-awsm-pic9
divuserpro-awsm-pic img9
management executive9
divemd-main divemd-filters9
img width9
divuserpro divemd-main9
86px divuserpro9
divuserpro-awsm-pic margin-left9
height 86px9
margin-left -48px9
86px height9
border 1px9
textareauserproeditor divuserpro-msg-overlay-content9
textarea divuserpro-notifier9
divuserpro-msg-overlay-content input9
divuserpro-online-item imguserpro-profile-badge9
width 50px9
50px height9
height 50px9
divuserpro-online-item-i width9
width 30px9
30px height9
height 30px9
divuserpro-online-item border-bottom9
border-bottom 0px9
0px important9
important padding9
divuserpro-online-item imguserpro-profile-badge-right9
999px important9
imguserpro-profile-badge-right max-width9
max-width 14px9
important max-height9
max-height 14px9
divuserpro-profile-img width9
width 80px9
80px divemd-user9
divemd-user width9
width 229
22 margin-left9
margin-left 29
2 important9
divuserpro-list-item-i width9
border-radius 999px9
input divuserpro-msg-overlay-content9
divuserpro-user margin-top9
divuserpro-msg-overlay-content textarea9
divuserpro-notifier font-family9
font-family roboto9
max-width 480px9
480px margin-left9
margin-left automargin-right9
automargin-right auto9
auto margin-bottom9
margin-bottom 30px9
max-width 250px9
max-width 1009
100 important9
15px margin-left9
span border-radius9
margin-left 30px9
30px margin-right9
margin-right 30px9
auserpro-user-img width9
120px height9
height 120px9
span top9
top -120px9
-120px line-height9
line-height 120px9
divuserpro-user divuserpro-user-link9
divuserpro-user-link width9
strategic human9
solid d3d3d39
brand management9
chain strategy9
name billing9
science using9
entertainment management9
open advanced9
last name8
management online8
first name8
advanced financial8
read more8
accounting auditing8
digital marketingadmission8
marketingadmission open8
analytics marketing8
marketing management8
translate-50 -508
prior python8
analytics prior8
artificial intelligence8
excel r8
strategy iim8
opacity 35s8
35s ease-in-out8
advanced strategic8
mica admission8
public relations8
leadership india8
india value8
advertising management8
media entertainment8
management combo8
managing brands8
management business7
strategic performance7
management courses7
managementexecutive certificate7
media strategy7
copal amba7
marketing social7
market research7
data action7
managementexecutive development7
open industrial7
type post7
brands marketing7
management public7
analytics 17
pgc business7
hr analytics7
amp change6
performance management6
divuserpro-317 divuserpro-user6
userpro-field-billingstatetemp selectval6
leadership change6
divuserpro-814 divuserpro-user6
divuserpro-974 divuserpro-user6
senior managers6
divuserpro-655 divuserpro-user6
brand sales6
selectval registerdiv6
know more6
capital leadership6
registerdiv userpro-field-billingstate6
lucknow advanced6
global supply6
divuserpro-163 divuserpro-user6
financial analytics6
ascent college6
forgot password6
divuserpro-565 divuserpro-user6
entrepreneurshipadmission open6
divuserpro-979 divuserpro-user6
your career6
position absolute6
divuserpro-857 divuserpro-user6
off campus6
open supply6
marketing communication6
registerdiv userpro-field-billingstatetemp6
divuserpro-471 divuserpro-user6
learning vs6
text-align center6
marketing digital6
amp public6
marketing certification6
open executive6
standard emi6
professional certification6
science online6
kozhikode admission6
analytics xlri6
r xlri6
leadership ecornell6
click-to-call number6
marketing mica6
rohtak iim6
resources management6
raipur admission6
media amp5
1 yr5
amp entertainment5
leadership executive5
hr hr5
open talent5
option-box form-control5
vs digital5
strategy management5
open project5
cyber warrior5
jqueryajax type5
media marketing5
open pgc5
analytics online5
account signup5
dont have5
important dont5
color 7979795
vs business5
resources leadershipadmission5
technology leadershipadmission5
analytics vs5
0 auto5
view all5
marketing courses5
analytics admission5
management vs5
open advertising5
profile email5
digital transformation5
management amp5
cstcp-iiit allahabad5
ecommerce business5
program fees5
0 social-inner5
noneborder-radius 05
content marketing5
using python5
font-size 12px5
0box-shadow noneborder-radius5
0border 0box-shadow5
marketing brand5
jamshedpur data5
leadership amp5
rgba0 05
svgfill fff5
success functionresponse5
marketing professional5
iim bangalore5
phd iim5
font-weight bold5
allahabad prayagraj5
post url5
url httpstalentedgecomwp-adminadmin-ajaxphp5
httpstalentedgecomwp-adminadmin-ajaxphp data5
pm ist5
colorfff social-inner5
nagar havelidaman5
iubh germany5
msc maths5
maths phd5
international financial4
color fff4
marketing trends4
supportcallbackbuttonpropdisabled false4
corporate-related-dialog-container gformwrapper4
ease-in-out transition4
cookie-strip-bar cookie-strip-bar-container4
corporate-related-dialog-wrapper form-block4
public relation4
transform translate-504
return false4
transition opacity4
have been4
using excel4
bangalore read4
2016 batch4
name last4
certification course4
amp supply4
job linked4
functionevent formid4
0 054
management course4
media max-width4
executive certification4
ease-in-out font-weight4
browse courses4
data analyticsadmission4
managersadmission open4
sales marketing4
python knowledge4
strategic leadership4
prayagraj admission4
indian institute4
administration iubh4
germany admission4
leadership xlri4
emi 04
marketing xlri4
management supply4
managers xlri4
management technology4
months emi4
loan amount4
gst loan4
amba financial4
management human4
open analytics4
management hr4
python knowledgeadmission4
knowledgeadmission open4
dppf downpayment4
open ecommerce4
padding 5px4
corporate finance4
0 padding4
risk managementadmission4
financial analyticsadmission4
display none4
business managers4
management machine4
value adds4
combo offer4
certified cyber4
analytics 3604
cursor pointer4
acca skills4
business managementadmission4
resources leadership4
project managementadmission4
leadership digital4
technology leadership4
logistics supply4
padding 04
downpayment gst4
pf dppf4
ddd solidpositionabsolute4
already have4
xlri faa4
faa registration4
international business4
0 option-box4
capital leadershipadmission4
strategic managementadmission4
auditing advanced4
python excel4
jamshedpur marketing4
border-right1px ddd4
hr analyticsadmission4
executive courses4
12px border-right1px4
sales management4
digital finance4
analytics market4
management marketing4
months program4
analytics analytics4
gst downpayment4
management leadership4
fees pf4
course lsbf4
transformational leadership4
campus mba4
offeradmission open4
combo offeradmission4
skills course4
analytics spjimr4
downpayment dp4
processing fees4
campus masters4
professional course4
academic partners4
dp processing4
entrepreneurship iim4
managers iim4
acca professional4
k premarajan3
rajat sharma3
more dr3
dr falguni3
dr r3
font-size 13px3
displayflex align-itemscenter3
help you3
dr rojers3
r k3
120px divuserpro-9793
pvt ltd3
table td3
120px divuserpro-6553
table th3
important divuserpro-6553
best suited3
courses best3
divuserpro-974 divuserpro-online-item3
120px divuserpro-9743
important divuserpro-9743
divuserpro-655 divuserpro-online-item3
divuserpro-814 divuserpro-online-item3
120px divuserpro-8143
important divuserpro-8143
account login3
important already3
divuserpro-317 divuserpro-online-item3
120px divuserpro-3173
display block3
border 03
important divuserpro-8573
eminent faculty3
divuserpro-979 divuserpro-online-item3
been scheduled3
course have3
familiarisation sessions3
platform familiarisation3
has been3
font-size 14px3
option-boxold pnth-childeven3
right management3
pnth-childeven width3
120px divuserpro-8573
important divuserpro-9793
font-size 16px3
auto width3
border-left 1px3
divuserpro-565 divuserpro-online-item3
120px divuserpro-5653
important divuserpro-5653
divuserpro-857 divuserpro-online-item3
phonecall-bottom-bar baloon3
number inputfocusoutlinenone3
letter-spacingnormal phonecall-bottom-bar3
12px border-radius3
all 05s3
transition all3
7c7c7c background-color3
solid 7c7c7c3
10px 10px3
5px padding3
border-radius 5px3
align-items center3
text-transform uppercase3
display flex3
position relative3
ul litwitter3
ul lipinterest3
ul lilinkedin3
ul ligplus3
ul lifacebook3
05s ease3
5px 03
0 option3
false supportcallbackbuttontextfailed3
border1px ddd3
inputwidth100displayblockheight36px border1px3
inputfocusoutlinenone important3
important callmodal3
spanheight36pxline-height36pxpadding0 12px3
10px 15px3
supportcallbackbuttontextfailed click3
required divuserpro-awsm-pic3
click-to-call lname3
solidpositionabsolute z-index993
return else3
5000 return3
let apikey3
please enter3
z-index99 callmodal3
bold corporate-related-dialog-wrapper3
border1px solid3
api call3
absolute width3
analyticsexecutive development3
background f4f4f43
inputhover callmodal3
reasons startups3
research amp3
accounting amp3
resource managementexecutive3
managementprofessional certificate3
managementpg certificate3
amp data3
data analyticsexecutive3
privacy policy3
instant callback3
afooter-quick-links-actiondisplayinline-block positionrelative3
calltoactions afooter-quick-links-actiondisplayinline-block3
max-width 768px3
left 503
online executive3
data vs3
minchars 33
mangement online3
true minchars3
highlight true3
true highlight3
hiddenmode true3
study human3
management certification3
amp sales3
chain mangement3
font-weight 6003
vs artificial3
emi standard3
between accounting3
background fff3
0 font-size3
marketing training3
management certificate3
vs data3
important divuserpro-3173
see vatican3
userpro-field-billingstatetempappendthis field3
fasoburundicambodiacamerooncanadacape verdecayman3
republicecuadoregyptel salvadorequatorial3
republicdenmarkdjiboutidominicadominican republicecuadoregyptel3
divoirecroatiacubacuraaocyprusczech republicdenmarkdjiboutidominicadominican3
ricacte divoirecroatiacubacuraaocyprusczech3
islandscosta ricacte3
thecook islandscosta3
democratic republic3
keeling islandscolombiacomoroscongocongo3
islandcocos keeling3
republicchadchilechinachristmas islandcocos3
african republicchadchilechinachristmas3
islandscentral african3
verdecayman islandscentral3
darussalambulgariaburkina fasoburundicambodiacamerooncanadacape3
guineaeritreaestoniaethiopiafalkland islands3
territorybrunei darussalambulgariaburkina3
ocean territorybrunei3
indian ocean3
islandbrazilbritish indian3
herzegovinabotswanabouvet islandbrazilbritish3
sint eustatius3
ofbonaire sint3
state ofbonaire3
plurinational state3
barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanbolivia plurinational3
islandsalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua3
countryafghanistanland islandsalbaniaalgeriaamerican3
select countryafghanistanland3
password select3
salvadorequatorial guineaeritreaestoniaethiopiafalkland3
islands malvinasfaroe3
password confirm3
peoples republic3
states ofmoldova3
federated states3
islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated3
ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia3
republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall3
yugoslav republic3
former yugoslav3
democratic republiclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedonia3
peoples democratic3
ofkuwaitkyrgyzstanlao peoples3
republic ofkuwaitkyrgyzstanlao3
ofkorea republic3
republic ofkorea3
democratic peoples3
malvinasfaroe islandsfijifinlandfrancefrench3
manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic3
republic ofiraqirelandisle3
islamic republic3
konghungaryicelandindiaindonesiairan islamic3
statehondurashong konghungaryicelandindiaindonesiairan3
city statehondurashong3
vatican city3
islandsholy see3
mcdonald islandsholy3
territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitiheard island3
southern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitiheard3
polynesiafrench southern3
guianafrench polynesiafrench3
islandsfijifinlandfrancefrench guianafrench3
confirm password3
phonenumber password3
republic ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew3
value addsadmission3
testing automation3
software testing3
ucla extension3
technology delhi3
leadership business3
transformationadmission open3
digital transformationadmission3
resources managementadmission3
hr strategic3
360admission open3
analytics 360admission3
analytics data3
addsadmission open3
cyber security3
financial statement3
entertainment media3
learning digital3
learning machine3
strategic leadershipadmission3
rohtak project3
management global3
analytics financial3
marketing managing3
finance financial3
admissions open3
international courses3
finance brand3
management finance3
linked programs3
equity research3
ethical hacking3
address phonenumber3
close reset3
e-mail address3
name e-mail3
member first3
close already3
signup back3
divuserpro-471 divuserpro-online-item3
120px divuserpro-4713
important divuserpro-4713
antispam questionanswer3
email antispam3
login username3
password back3
reset password3
divuserpro-163 divuserpro-online-item3
ankit fadia3
120px divuserpro-1633
important divuserpro-1633
password divuserpro-awsm-pic3
password forgot3
e-mail password3
password username3
close log3
login close3
degree courses3
jamshedpur iim3
jamshedpur hr3
lucknow marketing3
iiit bangalore3
assessment centers3
ofmoldova republic3
ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew caledonianew3
registerdiv userpro-field-billingstatetempappendthis3
billing first3
social network3
experience social3
industry experience3
designation industry3
email designation3
linkedin email3
email linkedin3
edit profile3
phone edit3
billing phone3
city billing3
billing city3
billing last3
full name3
linkedin check3
picture full3
profile picture3
profile pictureupload3
diudelhilakshadweeppuducherry referred3
amp diudelhilakshadweeppuducherry3
havelidaman amp3
amp nicobarchandigarhdadra3
bengalandaman amp3
pradeshwest bengalandaman3
nadutripurauttarakhanduttar pradeshwest3
pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil nadutripurauttarakhanduttar3
kashmirjharkhandkarnatakakeralamadhya pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil3
amp kashmirjharkhandkarnatakakeralamadhya3
pradeshjammu amp3
network linkedin3
end user3
pradesharunachal pradeshassambiharchhattisgarhgoagujaratharyanahimachal3
userpro-field-billingstatetempshow registerdiv3
ifregisterdiv userpro-field-billingstatetemp3
selectvalindia ifregisterdiv3
userpro-field-billingcountry selectvalindia3
ifregisterdiv userpro-field-billingcountry3
userpro-buttononclickfunction ifregisterdiv3
registerdiv userpro-buttononclickfunction3
userpro-field-billingstateshow registerdiv3
registerdiv userpro-field-billingstateshow3
userpro-field-billingstatetemphide registerdiv3
registerdiv userpro-field-billingstatetemphide3
else registerdiv3
userpro-field-billingstatehide else3
registerdiv userpro-field-billingstatehide3
registerdiv userpro-field-billingstatetempshow3
user agreement3
ifthisvalindia registerdiv3
inputval ifthisvalindia3
userpro-field-billingstate inputval3
selectonchangefunction registerdiv3
userpro-field-billingcountry selectonchangefunction3
registerdiv userpro-field-billingcountry3
userpro-warningremove registerdiv3
userpro-field-billingstatetemp userpro-warningremove3
ifthisval registerdiv3
inputvalthisval ifthisval3
userpro-field-billingstate inputvalthisval3
signupstatefieldsonchangefunction registerdiv3
registerdiv signupstatefieldsonchangefunction3
agreement registerdiv3
pradeshassambiharchhattisgarhgoagujaratharyanahimachal pradeshjammu3
state---andhra pradesharunachal3
caledonianew zealandnicaraguanigernigerianiuenorfolk3
luciasaint martin3
islandssomaliasouth africasouth3
partslovakiasloveniasolomon islandssomaliasouth3
dutch partslovakiasloveniasolomon3
maarten dutch3
leonesingaporesint maarten3
arabiascotlandsenegalserbiaseychellessierra leonesingaporesint3
principesaudi arabiascotlandsenegalserbiaseychellessierra3
marinosao tome3
grenadinessamoasan marinosao3
miquelonsaint vincent3
partsaint pierre3
french partsaint3
martin french3
nevissaint luciasaint3
south sandwich3
cunhasaint kitts3
da cunhasaint3
tristan da3
helena ascension3
barthlemysaint helena3
federationrwandasaint barthlemysaint3
ricoqatarrunionromaniarussian federationrwandasaint3
guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarrunionromaniarussian3
new guineaparaguayperuphilippinespitcairnpolandportugalpuerto3
territorypanamapapua new3
islandsnorwayomanpakistanpalaupalestinian territorypanamapapua3
mariana islandsnorwayomanpakistanpalaupalestinian3
islandnorthern mariana3
zealandnicaraguanigernigerianiuenorfolk islandnorthern3
africasouth georgia3
sandwich islandssouth3
---select state---andhra3
minor outlying3
state ---select3
billing state3
saharayemenzambiazimbabwe billing3
futunawestern saharayemenzambiazimbabwe3
islands uswallis3
britishvirgin islands3
islands britishvirgin3
namvirgin islands3
ofviet namvirgin3
republic ofviet3
bolivarian republic3
islandsuruguayuzbekistanvanuatuvenezuela bolivarian3
outlying islandsuruguayuzbekistanvanuatuvenezuela3
states minor3
islandssouth sudanspainsri3
statesunited states3
kingdomunited statesunited3
emiratesunited kingdomunited3
arab emiratesunited3
islandstuvaluugandaukraineunited arab3
caicos islandstuvaluugandaukraineunited3
republic ofthailandtimor-lestetogotokelautongatrinidad3
united republic3
chinatajikistantanzania united3
republictaiwan province3
arab republictaiwan3
mayenswazilandswedenswitzerlandsyrian arab3
jan mayenswazilandswedenswitzerlandsyrian3
sudanspainsri lankasudansurinamesvalbard3
media screen3
management364
marketing341
open202
digital171
data134
analytics132
amp114
program111
business109
financial107
097
leadership97
width96
admission93
strategic90
iim84
online83
important83
course73
learning69
xlri62
courses59
jamshedpur58
certification58
var56
divuserpro-user54
chain52
certificate49
human48
project47
max-width47
height46
supply46
30px45
machine44
media43
strategy43
hr43
big43
margin-left39
executive38
vs38
120px37
divuserpro36
auserpro-user-img36
registerdiv36
advanced32
function32
sales31
risk31
10px31
padding31
trends30
managementadmission29
mica28
divuserpro-msg-overlay-content27
divuserpro-online-item27
option-box26
technology26
callmodal26
science25
development24
republic24
st-124
124
top24
resource23
modal-content23
resources23
finance23
name23
masters22
brand21
solid21
auto21
14px21
lucknow20
social-inner20
you20
your20
rohtak20
fff20
password20
click-to-call20
50px19
input19
span19
professional19
leadershipadmission19
ul19
talent19
email19
border-radius18
textarea18
divuserpro-awsm-pic18
86px18
more18
corporate-related-dialog-wrapper18
-48px18
raipur18
public18
218
font-size17
talentedge17
international17
1px17
border17
else17
change16
applied16
social16
false16
ecornell15
have15
kozhikode15
html15
managers15
none15
15px15
profile15
billing15
managementexecutive15
close15
margin15
acca14
entrepreneurship14
content14
analyticsadmission14
general14
certified14
table14
0px14
accounting14
all14
divuserpro-81413
career13
display13
divuserpro-97913
divuserpro-31713
our13
emi13
gst13
divuserpro-47113
advertising13
divuserpro-65513
entertainment13
313
python13
divuserpro-97413
administration13
research13
divuserpro-16313
divuserpro-56513
divuserpro-85713
line-height13
india13
programs12
border-bottom12
innovation12
campus12
design12
select12
login12
capital12
industrial12
r12
between12
artificial12
position12
color12
opacity12
corporate-related-dialog-container12
right11
account11
center11
label11
relations11
indian11
dr11
global11
margin-bottom11
url11
if11
margin-right10
background10
margin-top10
performance10
experience10
phonecall-bottom-bar10
strategies10
max-height10
5px10
ahover10
us10
using10
12px10
49
type9
250px9
education9
80px9
divemd-user9
colorfff9
value9
intelligence9
-120px9
ddd9
imguserpro-profile-badge9
divuserpro-user-link9
59
999px9
divuserpro-list-item-i9
master9
divuserpro-online-item-i9
imguserpro-profile-badge-right9
divuserpro-profile-img9
font-family9
automargin-right9
69
spjimr9
democratic9
linkedin9
know9
font-weight9
480px9
fees9
islands9
img9
training9
divemd-main9
divemd-filters9
divuserpro-search-results9
divuserpro-label9
market9
divuserpro-field9
textareauserproeditor9
userpro-field-billingstatetemp9
divuserpro-notifier9
d3d3d39
roboto9
success9
faculty9
back8
months8
downpayment8
mobile8
ease-in-out8
return8
first8
best8
20px8
number8
35s8
action8
last8
searchdiv8
cyber8
auditing8
translate-508
brands8
bangalore8
true8
managing8
transform8
read8
pm8
2px8
mba8
marketingadmission8
been8
prior8
excel8
off8
popup-pay-opt8
senior8
combo8
background-color8
call7
phd7
use7
copal7
field7
blockchain7
amba7
analyticsexecutive7
security7
transition7
pgc7
click7
already7
text-align7
planning7
post7
absolute7
has7
77
settimeoutfunction6
required6
transformational6
job6
apikey6
peoples6
affiliate6
states6
left6
selectval6
ascent6
ifregisterdiv6
communication6
skills6
case6
college6
industry6
userpro-field-billingcountry6
ecommerce6
end6
fname6
userpro-field-billingstate6
entrepreneurshipadmission6
border1px6
username6
city6
flex6
forgot6
state6
86
startups6
we6
bold6
sessions6
ps6
also6
phonenumber6
like6
lname6
services6
id6
loan6
standard6
e-mail6
arab6
do6
time6
future6
form-block6
made6
calltoactions6
resolutions5
havelidaman5
nagar5
pradesharunachal5
organizations5
no5
pradeshjammu5
95
reasons5
seo5
very5
sharma5
box-shadow5
displayflex5
get5
my5
batch5
rgba05
guide5
maths5
let5
msc5
ltd5
documentreadyfunction5
world5
institutes5
ist5
working5
its5
browse5
ethical5
0border5
httpstalentedgecomwp-adminadmin-ajaxphp5
hacking5
functionresponse5
signup5
cstcp-iiit5
dont5
allahabad5
noneborder-radius5
0box-shadow5
prayagraj5
enterprise5
transformation5
iubh5
germany5
iift5
bank-select5
hp5
lsbf5
company5
valuation5
new5
form-control5
jqueryajax5
knowledge5
positionfixed5
warrior5
jan5
cookie-strip-bar5
view5
option5
yr5
processing5
logistics5
supportcallbackbuttonpropdisabled5
partners5
academic5
address5
svgfill5
pointer4
sep204
cursor4
year4
border-right1px4
iiit4
amount4
up4
live4
interactive4
autofill4
discover4
products4
can4
dp4
choose4
term4
pf4
dppf4
104
software4
fadia4
registration4
offer4
well4
adds4
handle4
knowledgeadmission4
managersadmission4
faa4
114
054
corporate4
z-index4
border-radius5px4
pgd4
offeradmission4
linked4
would4
study4
classroom4
callback4
option-boxold4
basic4
help4
through4
border-left4
tools4
p4
institute4
ajax4
confirmationcontent4
currentpage4
124
isredirect4
into4
0var4
httpsd37c7ubwjknfepcloudfrontnetwp-contentpluginsgravityformsimagesspinnergif4
inputhover4
solidpositionabsolute4
phone4
agreement4
user4
scope4
inputvaldataemailaddress4
traditional4
pr4
relation4
alertresponse4
onfailure4
visualization4
enter4
step4
entrepreneurs4
padding04
started4
advisor4
zopimfunction4
iftypeof4
gfglobal4
gformwrapper4
thinking4
cookie-strip-bar-container4
api4
find4
recovery4
key4
please4
formid4
functionevent4
undefined4
day4
scroll3
utmsource3
consolelogresponse3
paid3
visitorname3
women3
levels3
instant3
visitoremail3
inputwidth100displayblockheight36px3
start3
userpro-field-firstname3
top503
minchars3
highlight3
hiddenmode3
screen3
popped3
maskbghide3
maskbgshow3
gain3
recruiter3
social-popupafter3
block3
td3
133
yearu2019s3
inputvaldatafirstname3
mangement3
inputvaldataofa3
th3
policy3
visual3
7c7c7c3
branding3
0003
ligplus3
lilinkedin3
loantype3
lipinterest3
litwitter3
relative3
align-items3
05s3
lifacebook3
ease3
text-transform3
3px3
uppercase3
z-index993
143
why3
supportcallbackbuttontextfailed3
spanheight36pxline-height36pxpadding03
inputfocusoutlinenone3
153
163
terms3
fixed3
rate-box3
visitorphone3
privacy3
visitorutmterm3
analyst3
retry3
contact3
disaster3
visitorutmsource3
pnth-childeven3
genpact3
beginners3
red3
bottom03
right03
managementpg3
8px3
managementprofessional3
padding10px3
f4f4f43
text-decorationnone3
funds3
left503
nadutripurauttarakhanduttar3
positionrelative3
vatican3
ofmadagascarmalawimalaysiamaldivesmalimaltamarshall3
yugoslav3
former3
republiclatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedonia3
ofkuwaitkyrgyzstanlao3
ofkorea3
manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea3
ofiraqirelandisle3
islamic3
konghungaryicelandindiaindonesiairan3
statehondurashong3
see3
federated3
islandsholy3
mcdonald3
island3
territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitiheard3
southern3
polynesiafrench3
guianafrench3
islandsfijifinlandfrancefrench3
malvinasfaroe3
guineaeritreaestoniaethiopiafalkland3
salvadorequatorial3
islandsmartiniquemauritaniamauritiusmayottemexicomicronesia3
ofmoldova3
republicdenmarkdjiboutidominicadominican3
tristan3
vincent3
miquelonsaint3
pierre3
partsaint3
french3
martin3
luciasaint3
nevissaint3
kitts3
cunhasaint3
da3
ascension3
ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnew3
helena3
barthlemysaint3
federationrwandasaint3
ricoqatarrunionromaniarussian3
guineaparaguayperuphilippinespitcairnpolandportugalpuerto3
territorypanamapapua3
islandsnorwayomanpakistanpalaupalestinian3
mariana3
islandnorthern3
zealandnicaraguanigernigerianiuenorfolk3
caledonianew3
republicecuadoregyptel3
divoirecroatiacubacuraaocyprusczech3
marinosao3
ankit3
antispam3
reset3
log3
blog3
skilling3
degree3
aima3
jwmi3
centers3
assessment3
conference3
analysis3
173
statement3
equity3
automation3
testing3
extension3
ucla3
delhi3
transformationadmission3
360admission3
addsadmission3
admissions3
questionanswer3
member3
ricacte3
territorybrunei3
islandscosta3
thecook3
islandscolombiacomoroscongocongo3
keeling3
islandcocos3
republicchadchilechinachristmas3
african3
islandscentral3
verdecayman3
fasoburundicambodiacamerooncanadacape3
darussalambulgariaburkina3
ocean3
confirm3
islandbrazilbritish3
herzegovinabotswanabouvet3
sababosnia3
eustatius3
sint3
ofbonaire3
plurinational3
barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanbolivia3
samoaandorraangolaanguillaantarcticaantigua3
islandsalbaniaalgeriaamerican3
countryafghanistanland3
grenadinessamoasan3
tome3
afooter-quick-links-actiondisplayinline-block3
16px3
learn3
eminent3
scheduled3
familiarisation3
platform3
so3
role3
partner3
enhance3
list3
event3
suited3
gupta3
create3
userpro-field-billingstatetempappendthis3
selectvalindia3
userpro-buttononclickfunction3
userpro-field-billingstateshow3
userpro-field-billingstatetemphide3
userpro-field-billingstatehide3
userpro-field-billingstatetempshow3
ifthisvalindia3
inputval3
selectonchangefunction3
over3
pvt3
ifthisval3
me3
768px3
transparent3
letter-spacingnormal3
baloon3
positionabsolute3
justify-contentcenter3
align-itemscenter3
displaynone3
13px3
questions3
available3
helps3
ceo3
great3
team3
speak3
prof3
rajat3
premarajan3
k3
rojers3
area3
falguni3
professor3
userpro-warningremove3
inputvalthisval3
principesaudi3
lankasudansurinamesvalbard3
kingdomunited3
emiratesunited3
islandstuvaluugandaukraineunited3
caicos3
tobagotunisiaturkeyturkmenistanturks3
ofthailandtimor-lestetogotokelautongatrinidad3
united3
chinatajikistantanzania3
province3
republictaiwan3
mayenswazilandswedenswitzerlandsyrian3
sudanspainsri3
minor3
islandssouth3
sandwich3
south3
georgia3
africasouth3
islandssomaliasouth3
partslovakiasloveniasolomon3
dutch3
maarten3
leonesingaporesint3
arabiascotlandsenegalserbiaseychellessierra3
statesunited3
outlying3
signupstatefieldsonchangefunction3
bengalandaman3
agree3
check3
network3
designation3
edit3
full3
picture3
pictureupload3
referred3
diudelhilakshadweeppuducherry3
nicobarchandigarhdadra3
pradeshwest3
islandsuruguayuzbekistanvanuatuvenezuela3
pradeshmaharashtramanipurmeghalayamizoramnagalandodishapunjabrajasthansikkimtamil3
kashmirjharkhandkarnatakakeralamadhya3
pradeshassambiharchhattisgarhgoagujaratharyanahimachal3
state---andhra3
---select3
saharayemenzambiazimbabwe3
futunawestern3
uswallis3
britishvirgin3
namvirgin3
ofviet3
bolivarian3
currentid3

Who hosts Talentedge.in?

Talentedge.in Hosting Provider Information

Hosted IP Address:103.241.181.21
Hosted Hostname:static-103-241-181-21.ctrls.in
Service Provider:CtrlS Datacenters Ltd.
Hosted Country:IndiaIN
Location Latitude:19.0144
Location Longitude:72.8479
Webserver Software:Microsoft-IIS/8.5

Is "CtrlS Datacenters Ltd." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
CtrlS Datacenters Ltd.
0.0143%

HTTP Header Analysis for Talentedge.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 06 Apr 2021 07:11:57 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Server: nginx
Last-Modified: Tue, 06 Apr 2021 05:43:06 GMT
Vary: Accept-Encoding
ETag: W/"606bf4ea-f045e"
Cache-Control: public
Access-Control-Allow-Origin: : *
Content-Encoding: gzip

Talentedge.in Domain Nameserver Information

HostIP AddressCountry
ns-332.awsdns-41.com 205.251.193.76
ns-971.awsdns-57.net 205.251.195.203
ns-2009.awsdns-59.co.uk 205.251.199.217
ns-1291.awsdns-33.org 205.251.197.11


Need to find out who hosts Talentedge.in?


Domain Registration (WhoIs) information for Talentedge.in

 Domain Name: talentedge.in
Registry Domain ID: D5866541-IN
Registrar WHOIS Server:
Registrar URL: www.godaddy.com
Updated Date: 2019-03-06T22:58:31Z
Creation Date: 2012-02-17T11:04:28Z
Registry Expiry Date: 2023-02-17T11:04:28Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: TelentEdge
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: Delhi
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: IN
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: ns-332.awsdns-41.com
Name Server: ns-971.awsdns-57.net
Name Server: ns-2009.awsdns-59.co.uk
Name Server: ns-1291.awsdns-33.org
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-06T07:11:57Z

Websites with Similar Names

Talen-centrum.nl
Language Partners | Zakelijke taalcursussen in 52 talen
Talen-china.com
南京拓伦生物科技有限公司
Talen-group.com
TALEN Group
Talen-tu.com
talen-tu.com - Registered at Namecheap.com

Recently Updated Websites

Greasbypostoffice.com (2 seconds ago.)Snet.live (2 seconds ago.)Ww-payments.com (2 seconds ago.)Joeymazur.com (3 seconds ago.)Dipalipatil.com (3 seconds ago.)Shipcarte.net (3 seconds ago.)Cloud9dayspa.com (3 seconds ago.)Alleyesonmusic.com (4 seconds ago.)Newcitychina.com (4 seconds ago.)Photo4u.it (4 seconds ago.)Safillecollections.com (5 seconds ago.)Fitfeet.it (5 seconds ago.)Soho.coffee (5 seconds ago.)Gkmcanada.com (5 seconds ago.)Xxl-angeln.de (5 seconds ago.)Mielno.de (5 seconds ago.)Reshade.com (5 seconds ago.)Targetgroupllc.site (6 seconds ago.)2857yabo.com (6 seconds ago.)Caddyrich.com (6 seconds ago.)Drippingspringsseniorlink.org (6 seconds ago.)Entrustmentgroup.com (6 seconds ago.)Emssanar.org.co (6 seconds ago.)Hvfarmcoach.com (7 seconds ago.)Threesixtyprojects.com (7 seconds ago.)Zoc22.it (7 seconds ago.)Bostonsmarthouse.com (7 seconds ago.)Caduiattorney.com (7 seconds ago.)Hollandsehoogte.com (7 seconds ago.)Avtoservizi.net (7 seconds ago.)

Recently Searched Keywords

164 para (1 second ago.)cần bán đất (2 seconds ago.)clinicalkey (2 seconds ago.)tek bana header (2 seconds ago.)body code (3 seconds ago.)micro usb to dip çevirici pcb (3 seconds ago.)patent çeşitleri (3 seconds ago.)good vibes (3 seconds ago.)citrin (4 seconds ago.)bất động sản rạch giá (4 seconds ago.)tpa3110 (5 seconds ago.)hd 8k (5 seconds ago.)girly sound chords (6 seconds ago.)bất động sản hà tiên (6 seconds ago.)101 30 (7 seconds ago.)bất đống sản kiên giang (8 seconds ago.)locationhref href (9 seconds ago.)kablo erkek (10 seconds ago.)bán nhà phú quốc (10 seconds ago.)avm fritz (11 seconds ago.)lott (12 seconds ago.)kayna modl (12 seconds ago.)click for email address (13 seconds ago.)costing restaurant (13 seconds ago.)bán nhà p48 kđt phú cường (nhà vị trí đẹp, cơ hội phát triển), rạch giá, kiên giang (13 seconds ago.)5000tl sepete ekle (14 seconds ago.)bán nhà mặt tiền nguyễn trung trực chính chủ 1 trệt 1 lầu, an hoà rạch giá kiên giang (15 seconds ago.)(view my blog posts) (16 seconds ago.)nbsp zellkler kk (16 seconds ago.)capability (16 seconds ago.)