Tedi-shop.com  |  Günstig einkaufen im TEDi Onlineshop | TEDi-Shop
Low trust score  | 
Jetzt im TEDi Shop auch Online kaufen. Schnäppchen und günstige Produkte aus dem Alltag im TEDi Onlineshop. Wir bieten gute Qualität zu fairen Preisen.




Tedi-shop.com Website Information

Website Ranks & Scores for Tedi-shop.com

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:122,215
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:12%
DMOZ DMOZ Listing:No

Domain Information for Tedi-shop.com

Domain Registrar: UNITED-DOMAINS AG
Registration Date:2013-03-21  6 years 2 months 2 days ago
Last Modified:2015-07-25  3 years 9 months 4 weeks ago
Expiration Date:2016-03-21  3 years 1 month 4 weeks ago

Whois information for tedi-shop.com

Full Whois Lookup for Tedi-shop.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Tedi-shop.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: TEDI-SHOP.COM
Registry Domain ID: 1787900681_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.udag.net
Registrar URL: http://www.united-domains.de
Updated Date: 2017-03-22T07:26:12Z
Creation Date: 2013-03-21T16:00:25Z
Registry Expiry Date: 2018-03-21T16:00:25Z
Registrar: United-Domains AG
Registrar IANA ID: 1408
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.8151368670
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS.UDAG.DE
Name Server: NS.UDAG.NET
Name Server: NS.UDAG.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-31T06:09:31Z

Who hosts Tedi-shop.com?

Tedi-shop.com is hosted by rh-tec Business GmbH in Hessen, Frankfurt Am Main, Germany, 65931.
Tedi-shop.com has an IP Address of 62.216.171.231 and a hostname of 62.216.171.231.



Tedi-shop.com Web Server Information

Hosted IP Address:62.216.171.231
Hosted Hostname:62.216.171.231
Service Provider:rh-tec Business GmbH
Hosted Country:GermanyDE
Location Latitude:50.1155
Location Longitude:8.68417
Webserver Software:unknown

HTTP Header Analysis for Tedi-shop.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
X-Frame-Options: SAMEORIGIN
X-Cache-Debug: 1
Aoestatic: cache
X-Cache-Doesi: 1
Content-Encoding: gzip
X_AOESTATIC_FETCH: Removed cookie in vcl_fetch
X_OBJ_TTL: 57600.000
X-Purge-URL: /
X-Purge-Host: www.tedi-shop.com
Content-Length: 35502
Accept-Ranges: bytes
Date: Thu, 03 Sep 2015 17:09:01 GMT
X-Varnish: 289346542 288892210
Via: 1.1 varnish
Connection: close
X-Cache: HIT
X-Cache-Hits: 1862
X-Cache-Expires: Mon, 31 Mar 2008 10:00:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Expires: Mon, 31 Mar 2008 10:00:00 GMT
Age: 0


Need to find out who hosts Tedi-shop.com?

Tedi-shop.com Free SEO Report

Website Inpage Analysis for Tedi-shop.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Tedi-shop.com

productsslidercontainerkorkenqualittliitem maxwidthhalloween0 else functionelemproductslider110 productsslidercontainer productsslideritemseq1outerwidthtrueelse functionelem varproductsslidercontainer productsslider liitemimg maxwidth pxklicken100 neubeimaxwidth pxproductsslider liitem productimagewrappervar intervnum setinterval9availwidthab 050fingerneu weitereliitem imgliitempx maxheightonsuccesswidth itemseq0outerwidthtrue ifitemslengthintervnum 100productsslidercontainer productssliderelsevisibleeinkaufen4ifitemslength 1 width3ihremsetinterval function ifelemisvisibleclearinterval intervnum 100height 200px textalignfunctionelem varresize1000 neunew sliderelem 411clearinterval150 neu500 neuitemseq0outerwidthtrue ifitemslength 1itemseq0outerwidthtrueproductimagewrapper heighttextalign centerfindenliitem maxwidth 200pxneu200pxpxvisible newvisible new sliderelemcustomproductsslider liitem imgbertedimaxheightweihnachtennew sliderelemproductsslider2000 neufunction ifelemisvisible4 clearintervalifitemslength 1variants15hier200 neu7weihnachtsdekobanneridsonfailure onsuccess2partyzubehrsliderelemzupost100 varmaxwidth px maxheightfr4 clearinterval intervnumhabensiefunctionifelemisvisible is visibleproductslider477 productsslidercontainersicherheitcustom variantssetintervalbastelset07514setinterval functionproduktevar itemszumallesmaxheight 200pxauchneu in denwarenkorbproductslider213 productsslidercontainerliitem productimagewrapper heightfunctionelem var intervnum1 width itemslengthliitem img maxwidthtextalignifitemslengthihrifelemisvisiblehier klickenmethod500 neu weitere11 widtheinescrollsliderelem 4 clearintervalproductslider455 productsslidercontaineronfailuretouchlength250 neuimcmtrueifmeinartikeltselse functionelem8liitem productimagewrapperimg maxwidthproductsslider liitemmethod postclearinterval intervnumproductslider477 productsslidercontainer productssliderwidthkontoabweitere details800 neuif touchlengthproductslider213 productsslidercontainer productssliderpx maxheight 200pxdenintervnumnewproductslider110 productsslidercontainer050halloweendeko5suchederausitemseq0outerwidthtrue ifitemslengthmein warenkorb0diegnstigenvon10maxwidth13basteln12weidetailsvar intervnumitemslength itemseq1outerwidthtrueheight 200px0 elsejdocumentreadyfunctionvarjdocumentreadyfunction ifmititemslength100 neu weitere100 var itemsvar widthvar availwidthproductslider477width itemslength itemseq1outerwidthtruefreizeitintervnum setintervaloktoberfestproductimagewrapper height 200px6mit korken200px textalign centerheightumdekoproductslider455productslider455 productsslidercontainer productsslidervar width itemseq0outerwidthtruewidth itemseq0outerwidthtrueimgproductslider1101500 neuneu weitere detailsmaxwidth 200px400 neuamp200px textalignoderjdocumentreadyfunction if touchlengthcentergnstig16width itemslengthsliderelem 4itemsthisindexfreizeit ampxxlnewsletterintervnum setinterval functionproductimagewrapperheimwerkenweiterefunctionelemden warenkorb300 neuproductsslider liitem maxwidthproductslider213

Longtail Keyword Density for Tedi-shop.com

KeywordsOccurences
neu in den45
neu weitere details22
products-slider-container products-slider liitem12
else functionelem var4
var intervnum setinterval4
functionelem var intervnum4
width itemslength itemseq1outerwidthtrue4
1 width itemslength4
intervnum setinterval function4
0 else functionelem4
ifelemisvisible is visible4
4 clearinterval intervnum4
clearinterval intervnum 1004
sliderelem 4 clearinterval4
new sliderelem 44
itemseq0outerwidthtrue ifitemslength 14
visible new sliderelem4
setinterval function ifelemisvisible4
ifitemslength 1 width4
product-image-wrapper height 200px4
height 200px text-align4
width itemseq0outerwidthtrue ifitemslength4
liitem product-image-wrapper height4
products-slider liitem product-image-wrapper4
products-slider liitem max-width4
liitem max-width 200px4
products-slider liitem img4
200px text-align center4
100 var items4
liitem img max-width4
jdocumentreadyfunction if touchlength4
var width itemseq0outerwidthtrue4
px max-height 200px4
img max-width px4
max-width px max-height4
productslider455 products-slider-container products-slider3
productslider477 products-slider-container products-slider3
100 neu weitere3
productslider110 products-slider-container products-slider3
productslider213 products-slider-container products-slider3
500 neu weitere3
den warenkorb60
weitere details35
neu weitere22
products-slider liitem12
products-slider-container products-slider12
150 neu9
400 neu8
100 neu8
300 neu7
1500 neu5
img max-width5
500 neu5
var intervnum4
intervnum setinterval4
setinterval function4
functionelem var4
else functionelem4
width itemslength4
itemslength itemseq1outerwidthtrue4
0 else4
ab 0504
2000 neu4
4 clearinterval4
clearinterval intervnum4
intervnum 1004
ifitemslength 14
sliderelem 44
200 neu4
visible new4
new sliderelem4
function ifelemisvisible4
1 width4
200px text-align4
text-align center4
liitem img4
px max-height4
height 200px4
product-image-wrapper height4
liitem max-width4
max-width 200px4
liitem product-image-wrapper4
max-height 200px4
max-width px4
var availwidth4
var width4
width itemseq0outerwidthtrue4
itemseq0outerwidthtrue ifitemslength4
1000 neu4
var items4
jdocumentreadyfunction if4
if touchlength4
100 var4
onfailure onsuccess3
method post3
productslider455 products-slider-container3
freizeit amp3
custom variants3
productslider477 products-slider-container3
hier klicken3
productslider213 products-slider-container3
mein warenkorb3
mit korken3
800 neu3
250 neu3
productslider110 products-slider-container3
warenkorb69
neu67
amp66
den62
details35
weitere35
var30
022
mit18
cm15
sie14
liitem12
products-slider12
products-slider-container12
ab12
200px12
width12
function11
19
max-width9
29
new9
oder8
die8
if8
38
zum8
48
intervnum8
hier7
else7
57
67
height7
77
items6
86
zu6
gnstigen6
tedi6
halloween5
xxl5
img5
produkte5
95
der5
custom5
artikel5
px5
von5
105
0505
115
125
sliderelem4
setinterval4
ifelemisvisible4
visible4
clearinterval4
134
fr4
alles4
eine4
variants4
im4
einkaufen4
scroll4
wei4
oktoberfest4
qualitt4
thisindex4
functionelem4
ihrem4
basteln4
144
center4
text-align4
bannerids4
itemseq1outerwidthtrue4
product-image-wrapper4
mein4
max-height4
ifitemslength4
154
itemseq0outerwidthtrue4
touchlength4
jdocumentreadyfunction4
availwidth4
itemslength4
post3
onfailure3
ts3
productslider1103
onsuccess3
auch3
method3
finden3
heimwerken3
ihr3
freizeit3
sicherheit3
gnstig3
bei3
partyzubehr3
ber3
resize3
0753
um3
bastelset3
korken3
weihnachten3
productslider2133
haben3
finger3
klicken3
halloween-deko3
true3
konto3
deko3
productslider4773
productslider4553
newsletter3
weihnachtsdeko3
163
aus3
suche3

What are the nameservers for tedi-shop.com?

Tedi-shop.com Domain Nameserver Information

HostIP AddressCountry
ns.udag.net 89.31.141.10Germany Germany

Tedi-shop.com Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Tedi-shop.com is a scam?