O Tempo para 14 dias - tempo.pt

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 244,469
Estimated Worth: $40,500
Category: News and Media > Weather

O tempo em Portugal e em todo o mundo para 14 dias, informe-se gratuitamente das previsões do tempo por hora e condições actuais.



Domain summary

Last updated
2021-04-15
Domain label
tempo
Domain extension
pt
Global Traffic Rank
244,469
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$40,500
Estimated daily income
$75
Estimated monthly income
$2,281

Rank summary

How is tempo.pt ranked relative to other sites:

Percentage of visits to tempo.pt from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Tempo.pt registered?
A: Tempo.pt was registered 4 days, 16 hours, 43 minutes, 15 seconds ago on Thursday, April 15, 2021.
Q: When was the WHOIS for Tempo.pt last updated?
A: The WHOIS entry was last updated 4 days, 16 hours, 43 minutes, 15 seconds ago on Thursday, April 15, 2021.
Q: What are Tempo.pt's nameservers?
A: DNS for Tempo.pt is provided by the following nameservers:
  • marek.ns.cloudflare.com
  • emily.ns.cloudflare.com
Q: Who is the registrar for the Tempo.pt domain?
A: The domain has been registered at .
Q: What is the traffic rank for Tempo.pt?
A: Tempo.pt ranks 244,469 globally on Alexa. Tempo.pt has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Tempo.pt each day?
A: Tempo.pt receives approximately 6,713 visitors and 26,852 page impressions per day.
Q: What IP address does Tempo.pt resolve to?
A: Tempo.pt resolves to the IPv4 address 104.18.198.19.
Q: In what country are Tempo.pt servers located in?
A: Tempo.pt has servers located in the United States.
Q: What webserver software does Tempo.pt use?
A: Tempo.pt is powered by CloudFlare webserver.
Q: Who hosts Tempo.pt?
A: Tempo.pt is hosted by CloudFlare, Inc. in United States.
Q: How much is Tempo.pt worth?
A: Tempo.pt has an estimated worth of $40,500. An average daily income of approximately $75, which is roughly $2,281 per month.

Tempo.pt Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tempo.pt Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Tempo.pt

H1 Headings

1 :
  1. O Tempo para 14 dias Portugal

H2 Headings

22 :
  1. Aveiro
  2. Braga
  3. Bragança
  4. Castelo Branco
  5. Coimbra
  6. Cuba
  7. Évora
  8. Faro
  9. Funchal
  10. Guarda
  11. Leiria
  12. Lisboa
  13. Ourique
  14. Ponta Delgada
  15. Portalegre
  16. Porto
  17. Santarém
  18. Setúbal
  19. Viana do Castelo
  20. Vila Real
  21. Viseu
  22. tempo.pt

H3 Headings

4 :
  1. Notícias
  2. Distritos de Portugal
  3. Meteorologia até 14 dias para Portugal
  4. O tempo no seu Site

H4 Headings

4 :
  1. Fim de semana de tréguas na instabilidade: durará muito?
  2. Erupção do vulcão La Soufrière ao fim de 40 anos
  3. Alterações climáticas e migração: o exemplo dos Himalaias
  4. Tempo adverso no centro e sul do país

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

8 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

61:

Links - Internal (nofollow)

0:

Links - Outbound

24:

Links - Outbound (nofollow)

0:

Keyword Cloud for Tempo.pt

divdivginnerhtml var divifodivdividif pantallaglobalvar div documentcreateelementdocumentcreateelement div divginnerhtmldocumentcreateelement scriptscripttype textjavascriptscriptinnerhtmlnewdivappendchildscriptscripttype textjavascriptscriptinnerhtmlvar divgscripttype textjavascript scriptinnerhtmlscriptscripttypescriptscripttype textjavascriptdivgappendchild divdocumentcreateelementscript documentcreateelementdocumentcreateelement divdivginnerhtml varfunctiongoogletagcmdpushfunctiondivgappendchildscriptinnerhtmldivginnerhtml varpublicidadedivg documentcreateelementdiv divginnerhtml vartextjavascript scriptinnerhtml googletagcmdpushfunctiondiv documentcreateelementdivdivginnerhtml var divdocumentcreateelement divdivginnerhtmlvardocumentcreateelement scriptscripttypediv documentcreateelement divdividpantallaglobaltextjavascriptscriptinnerhtmlscript documentcreateelement scriptscripttypevar divvar divg documentcreateelementdiv dividwescriptinnerhtml googletagcmdpushfunctiontextjavascript scriptinnerhtmldivdivginnerhtml varscriptscripttype textjavascriptscriptinnerhtml googletagcmdpushfunctiondivgdivg documentcreateelement divvar scripttextjavascriptabriltextjavascriptscriptinnerhtml googletagcmdpushfunctiondiv documentcreateelement divdiv divginnerhtmldivdivginnerhtmldividdocumentcreateelement divdivginnerhtmldocumentcreateelement divdividscripttypedivg documentcreateelement divdivginnerhtmldocumentcreateelement div divid

Longtail Keyword Density for Tempo.pt

KeywordsOccurences
var divg documentcreateelement6
var div documentcreateelement6
divg documentcreateelement divdivginnerhtml3
documentcreateelement scriptscripttype textjavascriptscriptinnerhtml3
script documentcreateelement scriptscripttype3
div documentcreateelement divdivid3
divdivginnerhtml var div3
documentcreateelement divdivginnerhtml var3
scripttype textjavascript scriptinnerhtml3
textjavascript scriptinnerhtml googletagcmdpushfunction3
divg documentcreateelement div3
documentcreateelement div divid3
div documentcreateelement div3
divginnerhtml var div3
div divginnerhtml var3
documentcreateelement div divginnerhtml3
scriptscripttype textjavascriptscriptinnerhtml googletagcmdpushfunction3
if pantallaglobal6
var div6
divg documentcreateelement6
documentcreateelement div6
var divg6
div documentcreateelement6
script documentcreateelement5
divginnerhtml var3
div divid3
var script3
div divginnerhtml3
scripttype textjavascript3
textjavascript scriptinnerhtml3
scriptinnerhtml googletagcmdpushfunction3
divgappendchild div3
documentcreateelement divdivginnerhtml3
divdivginnerhtml var3
documentcreateelement divdivid3
documentcreateelement scriptscripttype3
scriptscripttype textjavascriptscriptinnerhtml3
textjavascriptscriptinnerhtml googletagcmdpushfunction3
var35
documentcreateelement17
div16
abril14
new11
divg11
script10
pantallaglobal8
if6
googletagcmdpushfunction6
divappendchild5
we4
textjavascript3
scripttype3
divid3
divgappendchild3
o3
divginnerhtml3
publicidade3
divdivginnerhtml3
divdivid3
scriptscripttype3
textjavascriptscriptinnerhtml3
function3
scriptinnerhtml3

Who hosts Tempo.pt?

Tempo.pt Hosting Provider Information

Hosted IP Address:104.18.198.19
Hosted Hostname:104.18.198.19
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
CloudFlare, Inc.
1.5273%

HTTP Header Analysis for Tempo.pt

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 15 Apr 2021 21:36:53 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
CF-Ray: 64084fddc96a542e-LHR
Age: 1731
Cache-Control: public, max-age=3118
Expires: Thu, 15 Apr 2021 22:00:00 GMT
Vary: Accept-Encoding, User-Agent
CF-Cache-Status: HIT
cf-request-id: 0979103e9f0000542e15214000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
meteored-cf-units: true
meteored-cf-usercountry: true
Meteored-Design: 2017
Meteored-Site: pt
Meteored-Worker: true
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
Server: cloudflare
Content-Encoding: gzip
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Tempo.pt Domain Nameserver Information

HostIP AddressCountry
marek.ns.cloudflare.com 108.162.193.202
emily.ns.cloudflare.com 108.162.192.155


Need to find out who hosts Tempo.pt?


Domain Registration (WhoIs) information for Tempo.pt

 Domain: tempo.pt
Domain Status: Registered
Creation Date: 26/03/2009 19:02:06
Expiration Date: 28/02/2022 23:59:00
Owner Name: Alpred ,S.L.
Owner Address: Patron 9
Owner Locality: Almendricos
Owner ZipCode: 30893
Owner Locality ZipCode: Almendricos
Owner Country Code: ES
Owner Email: Login to show email
Name: ARSYS INTERNET S.L.
Admin Address: Calle Madre de Dios 21
Admin Locality: La Rioja
Admin ZipCode: 26004
Admin Locality ZipCode: Logrono La Rioja
Admin Country Code: ES
Admin Email: Login to show email
Login to show email
Server: marek.ns.cloudflare.com | IPv4: and IPv6:
Name Server: emily.ns.cloudflare.com | IPv4: and IPv6:

Websites with Similar Names

Tempo-2rad.de
Tempo-Zweirad-Treff GmbH
Tempo-aerospace.com
Tempo Aerospace
Tempo-air.com
tempo-air.com
Tempo-arts.com
Index of /
Tempo-baade.dk
Forside - Tempo Både ApS
Tempo-betpaykart.com
Yeni Para Yat?rma Sistemi

Recently Updated Websites

Umnlodge.com (1 second ago.)Autonomoszaragoza.com (1 second ago.)Dodsecops.com (1 second ago.)Wixiswack.com (1 second ago.)Crypticgroup.com (1 second ago.)Bigsteelleather.com (2 seconds ago.)Whistlingpines.org (3 seconds ago.)Xsvmedia.com (3 seconds ago.)Pacificqualitygroup.com (3 seconds ago.)1959eldorado.at (3 seconds ago.)N1lgg.com (3 seconds ago.)Kvdpro.com (3 seconds ago.)Rabbitfootmusic.com (3 seconds ago.)Bryanmooney.com (3 seconds ago.)Jojoisland.store (4 seconds ago.)Joli.games (4 seconds ago.)Nuclearcpu.com (4 seconds ago.)Newalienworlds.com (4 seconds ago.)Jalalo.com (4 seconds ago.)Powersystemautomation.com (5 seconds ago.)Dadwich.com (5 seconds ago.)Thetransmodern.com (5 seconds ago.)Autobuy.io (5 seconds ago.)Hagdycarolhola.ml (5 seconds ago.)Takiwatangajumuia.org (5 seconds ago.)Bitesizedmarketingtips.com (5 seconds ago.)Indianastatefairparking.com (6 seconds ago.)Databucketpro.com (6 seconds ago.)Vanlint.nl (6 seconds ago.)Chicagosportsinfo.com (6 seconds ago.)

Recently Searched Keywords

reparaturen und einfassungen (2 seconds ago.)广告刊登合约 (2 seconds ago.)milk chocolate hair color (8 seconds ago.)5 bước làm cá thu một nắng rim nước dừa cả nhà cùng mê cá thu một nắng rim nước dừa được chế biến đơn giản nhưng vẫn đảm [...] (9 seconds ago.)maternelle au cinéma (12 seconds ago.)solarcunto (23 seconds ago.)21102 color (29 seconds ago.)تور زیارتی (43 seconds ago.)the eckersley lecture (1 minute ago.)广告刊登优化 (1 minute 2 seconds ago.)iş makinaları yağ keçeleri (1 minute 3 seconds ago.)5 bước làm cá thu một nắng rim nước dừa cả nhà cùng mê cá thu một nắng rim nước dừa được chế biến đơn giản nhưng vẫn đảm [...] (1 minute 5 seconds ago.)hawaii womens feminine (1 minute 6 seconds ago.)cilindra bloks samsung r407 melns - clt-r407 (1 minute 10 seconds ago.)ronda de dalt (1 minute 13 seconds ago.)baukasten (1 minute 14 seconds ago.)externo (1 minute 18 seconds ago.)estate inca (1 minute 20 seconds ago.)2019chatbubbleoutline0 read (1 minute 35 seconds ago.)虚拟资源网 (1 minute 37 seconds ago.)key value (1 minute 45 seconds ago.)localización en ibiza (1 minute 49 seconds ago.)sustainability call (1 minute 51 seconds ago.)706402202 (1 minute 53 seconds ago.)wisconsin medical marijuana delivery service (1 minute 54 seconds ago.)����ҵ��ҳ (1 minute 55 seconds ago.)discover website (1 minute 58 seconds ago.)5 bước làm cá thu một nắng rim nước dừa cả nhà cùng mê cá thu một nắng rim nước dừa được chế biến đơn giản nhưng vẫn đảm [...] (2 minutes 1 second ago.)locksmith placentia (2 minutes 2 seconds ago.)广告刊登政策 ig (2 minutes 3 seconds ago.)