Tempusshop.ru  |  
Low trust score  | 



Tempusshop.ru Website Information

Website Ranks & Scores for Tempusshop.ru

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for tempusshop.ru

Full Whois Lookup for Tempusshop.ru Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Tempusshop.ru. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: TEMPUSSHOP.RU
nserver: u1.hoster.by.
nserver: u2.hoster.by.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created: 2015-10-06T08:53:39Z
paid-till: 2019-10-06T08:53:39Z
free-date: 2019-11-06
source: TCI

Last updated on 2019-02-10T13:11:33Z

Who hosts Tempusshop.ru?

Tempusshop.ru is hosted by in .
Tempusshop.ru has an IP Address of and a hostname of .



Tempusshop.ru Web Server Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. )

Nevada NewsMakers
- nevadanewsmakers.com

  10,919,449   $ 8.95

Ligmincha France et Suisse romande
- ligmincha.fr

  4,500,519   $ 240.00

Comment gagner de l'argent? Voici le TOP pour gagner des euros!
- leclubargent.com

Toutes les solutions pour gagner de l'argent rapidement et facilement au quotidien et sur internet. Le Club Argent c'est 100% fiable!

  Not Applicable   $ 0.00

Ecozen - Agriculture Technology | Post Harvest management |...
- ecozensolutions.com

Ecozen Solution is Technology in agriculture driven product Development Company provides renewable energy based products to increase farmer income.

  Not Applicable   $ 0.00

UK Write My Essay
- ukwritemyessay.com

  Not Applicable   $ 0.00

HTTP Header Analysis for Tempusshop.ru



Need to find out who hosts Tempusshop.ru?

Tempusshop.ru Free SEO Report

Website Inpage Analysis for Tempusshop.ru

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Tempusshop.ru

lastjctitlesearch waitimageajaxpage containeridbottomsubmenu ulsubmenu liremoveclassselectednnewbitrixthemesdefaultimageswaitgif ajaxpage containeridtimextitaniumthisparentsformfindbuttontypesubmitremoveclasshoverleatherfossilulsubmenu liclickfunction bottomsubmenusitem more submenudwmenuwidthajaxpagesasyncjscontrolitem morefunctionslideshowspeedceramicquartztextjavascript sasync trueshowelsemoredknybottomsubmenu ulsubmenu liclickfunctionstyperoot itemsifcntitemsinmorebitrixthemesdefaultimageswaitgif ajaxpageleather steelwaitimage4items of menuywaitimage bitrixthemesdefaultimageswaitgif ajaxpagesports3liremoveclassselectedfalsewidth varitemsulsubmenu liremoveclassselecteditemwidthclassicstype textjavascriptinputidnew jctitlesearchclassicsjscontrol newssrcfadevar jscontrol newstype textjavascript sasyncwcautomaticbitrixthemesdefaultimageswaitgiftextjavascript sasyncsubmenujctitlesearchifmore submenuregexpchronochronographfthisaddclassselectedwidthclonedemptysasync true ssrcjscontrol new jctitlesearchmenuulsubmenu liremoveclassselected thisaddclassselectedulsubmenu liclickfunctionnodestyledisplayulsubmenutrueelementhide1rootwomenvalueminquerylenbottomsubmenu ulsubmenuwaitimage bitrixthemesdefaultimageswaitgifsasync truevar jscontrolklein20minquerylen 2containeridliclickfunction bottomsubmenu ulsubmenujctitlesearch waitimage bitrixthemesdefaultimageswaitgifsteelliclickfunction bottomsubmenustrliblockdocumentreadyfunctiontrue ssrcitemitsliremoveclassselected thisaddclassselectednodecatalogmenulastcalculatedwidthvaritems moreinlineblocktextjavascriptbottomsubmenunew jctitlesearch waitimagewindowliclickfunctionthisparentsformfindbuttontypesubmitaddclasshovercloned item

Longtail Keyword Density for Tempusshop.ru

KeywordsOccurences
var jscontrol new3
jscontrol new jctitlesearch3
new jctitlesearch waitimage3
jctitlesearch waitimage bitrixthemesdefaultimageswaitgif3
waitimage bitrixthemesdefaultimageswaitgif ajaxpage3
bitrixthemesdefaultimageswaitgif ajaxpage containerid3
item more submenu3
items of menu3
bottomsubmenu ulsubmenu liclickfunction3
ulsubmenu liclickfunction bottomsubmenu3
liclickfunction bottomsubmenu ulsubmenu3
bottomsubmenu ulsubmenu liremoveclassselected3
ulsubmenu liremoveclassselected thisaddclassselected3
stype textjavascript sasync3
textjavascript sasync true3
sasync true ssrc3
bottomsubmenu ulsubmenu6
item more6
leather steel4
root items4
more submenu4
cloned item3
sasync true3
textjavascript sasync3
stype textjavascript3
liremoveclassselected thisaddclassselected3
ulsubmenu liremoveclassselected3
liclickfunction bottomsubmenu3
ulsubmenu liclickfunction3
var jscontrol3
items more3
jscontrol new3
width var3
minquerylen 23
ajaxpage containerid3
bitrixthemesdefaultimageswaitgif ajaxpage3
waitimage bitrixthemesdefaultimageswaitgif3
jctitlesearch waitimage3
new jctitlesearch3
true ssrc3
var42
menu17
item15
n11
true10
function9
more9
y9
items8
new7
steel7
women7
submenu7
leather7
else7
bottomsubmenu6
f6
s6
last6
06
ulsubmenu6
15
width5
false5
if5
documentreadyfunction5
root5
automatic5
regexp4
wc4
cloned4
dkny4
fossil4
its4
value4
dw4
textjavascript4
chronograph4
classic4
ceramic4
24
element4
liclickfunction3
ssrc3
slideshowspeed3
itemwidth3
strliblock3
sasync3
thisaddclassselected3
liremoveclassselected3
empty3
stype3
fade3
ifcntitemsinmore3
inline-block3
quartz3
nodestyledisplay3
minquerylen3
klein3
timex3
jscontrol3
jctitlesearch3
waitimage3
bitrixthemesdefaultimageswaitgif3
ajaxpage3
containerid3
inputid3
thisparentsformfindbuttontypesubmitaddclasshover3
show3
thisparentsformfindbuttontypesubmitremoveclasshover3
sports3
33
chrono3
titanium3
classics3
43
nodecatalogmenulastcalculatedwidth3
menuwidth3
hide3
window3

What are the nameservers for tempusshop.ru?

Tempusshop.ru Domain Nameserver Information

HostIP AddressCountry
u1.hoster.by 93.125.30.201Belarus Belarus
u2.hoster.by 178.172.236.142Belarus Belarus

Tempusshop.ru DNS Record Analysis DNS Lookup

HostTypeTTLExtra
fffIP: f
Priority: f
Target: f
TXT: f
CPU: f
OS: f
MNAME: f
RNAME: f
Serial: f
Refresh: f
Retry: f
Expire: f
IPV6: f
MASKLEN: f
Chain: f
Weight: f
Port: f
Order: f
Pref: f
Flags: f
Services: f
REGEX: f
Replacement: f

Alexa Traffic Rank for Tempusshop.ru


Alexa Search Engine Traffic for Tempusshop.ru