|  Tennis World - Tennis News - Tennis Video Lessons and Free Online Games
Low trust score  | 
Tennis World ? Online Tennis Portal ? everyday Tennis News, 3 online tennis games and free tennis video lessons. Website Information has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 90,561, a Majestic Rank of 147,101, a Domain Authority of 40% and is not listed in DMOZ. is hosted by CloudFlare, Inc. in United States. has an IP Address of and a hostname of

The domain was registered 9 years 4 weeks 2 days ago by , it was last modified 201 decades 9 years 3 days ago and currently is set to expire 201 decades 9 years 3 days ago.

Whois information for

Full Whois Lookup for Whois Lookup

Registry Domain ID: D160154032-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-09-18T20:09:06Z
Creation Date: 2010-09-15T15:55:13Z
Registry Expiry Date: 2017-09-15T15:55:13Z
Registrar Registration Expiration Date:
Registrar: Register.IT SPA
Registrar IANA ID: 168
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok
Registry Registrant ID: C95121338-LROR
Registrant Name: Federico Coppini
Registrant Organization: Federico Coppini
Registrant Street: Piazza T. Tasso 8
Registrant City: Ferrara
Registrant State/Province: FE
Registrant Postal Code: 44100
Registrant Country: IT
Registrant Phone: +39.3396004848
Registrant Phone Ext:
Registrant Fax: +39.0532343112
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C95121339-LROR
Admin Name: Coppini Federico
Admin Organization: Federico Coppini
Admin Street: Piazza T. Tasso 8
Admin City: Ferrara
Admin State/Province: FE
Admin Postal Code: 44100
Admin Country: IT
Admin Phone: +39.3396004848
Admin Phone Ext:
Admin Fax: +39.0532343112
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C6744170-LROR
Tech Name: REGISTER.IT S.p.a.
Tech Organization: REGISTER.IT S.p.a.
Tech Street: Viale della Giovine Italia 17
Tech City: Firenze
Tech State/Province: FI
Tech Postal Code: 50122
Tech Country: IT
Tech Phone: +39.0353230300
Tech Phone Ext:
Tech Fax: +39.0353230312
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS2.A2HOSTING.COM
Name Server: NS3.A2HOSTING.COM
Name Server: NS4.A2HOSTING.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-17T12:34:06Z

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 26 Jul 2015 13:10:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.5.9-1ubuntu4.9
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Server: cloudflare-nginx
CF-RAY: 20c057a8b76b138f-LHR
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

transition allmargin0pxtextdecorationnonelinear cursorpointerrogerscolorfffroger federer200ms linear cursorpointertennis interviewswilliamslinearall 200ms linearfunction varmurrayiffontweightboldfunctionvarartbigberdych200msidpositionrelativecursorpointertransition039icupinterviewsfedererrsallserena williamsartx200ms lineartransition all 200msjoinsserenaall 200msbackgroundlineargradienttofontfamilysansseriftennisrankingatp

Longtail Keyword Density for

transition all 200ms5
all 200ms linear5
200ms linear cursorpointer3
transition all6
roger federer6
200ms linear5
all 200ms5
function var4
serena williams4
tennis interviews3
linear cursorpointer3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?