Testberichte.de  |  Test- und Verbraucherinformation bei Testberichte.de
Low trust score  | 
Testberichte.de: Mehr als 650.000 Testergebnisse im Überblick

Testberichte.de Website Information

Website Ranks & Scores for Testberichte.de

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:6,374
Majestic Rank Majestic Rank:24,597
Domain Authority Domain Authority:67%
DMOZ DMOZ Listing:No

Whois information for testberichte.de

Full Whois Lookup for Testberichte.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Testberichte.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html

Domain: testberichte.de
Nserver: ns1.testberichte.de
Nserver: nsb6.schlundtech.de
Nserver: nsc6.schlundtech.de
Status: connect
Changed: 2017-05-24T12:26:39+02:00

Name: Holger Gröhn
Organisation: Producto AG
Address: Kreuzbergstr. 30
PostalCode: 10965
City: Berlin
CountryCode: DE
Phone: +49-30-91207103
Fax: +49-30-91207111
Email: Login to show email

Name: Holger Gröhn
Organisation: Producto AG
Address: Kreuzbergstr. 30
PostalCode: 10965
City: Berlin
CountryCode: DE
Phone: +49-30-91207103
Fax: +49-30-91207111
Email: Login to show email

Who hosts Testberichte.de?

Testberichte.de is hosted by QSC AG in Bayern, Furth, Germany, 82041.
Testberichte.de has an IP Address of and a hostname of www.testberichte.de.

Testberichte.de Web Server Information

Hosted IP Address:
Hosted Hostname:www.testberichte.de
Service Provider:QSC AG
Hosted Country:GermanyDE
Location Latitude:48.0291
Location Longitude:11.5965
Webserver Software:Not Applicable

HTTP Header Analysis for Testberichte.de

Http-Version: 1.0
Status-Code: 200
Status: 200 OK
Last-Modified: Mon, 08 Jun 2015 16:38:47 GMT
Content-Language: de-DE
Content-Encoding: gzip
Content-Length: 10753
Content-Type: text/html;charset=UTF-8
Date: Mon, 08 Jun 2015 23:14:41 GMT
Server: Apache
Vary: Accept-Encoding
X-Cache: HIT from www.testberichte.de
X-Cache-Lookup: HIT from www.testberichte.de:80
Via: 1.1 fidschi.testberichte.de:80 (squid)
Connection: close

Need to find out who hosts Testberichte.de?

Testberichte.de Free SEO Report

Website Inpage Analysis for Testberichte.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Testberichte.de

ipadsnull else logmessagespushmessagetypeofloggervarindexbersvfraboif typeoflogger objecttruetablets apple ipadsipads androidtabletsdichtype1nullkategoriendiewertenelsepfeilnavilinks back schliessenpfeilnavilinksfrtestberichte0 method0 null elsetablets appletablets0selectorcontext selectorfnmoddfpdfpdefineslotadunitpathlogmessagespushmessageauswertungsystemkamerascpback schliessenif typeofloggeraddhandleronclassnameapple ipads androidtabletsfr dichobjectfestplattenapple ipadstypeoflogger objectyaparamsindex 0newtypeofmethod addhandleronclassnameifmehridfunctionbacknull elsedascontextschliessen0 method addhandleronclassname0 nullcpcodeelse logmessagespushmessagewirpfeilnavilinks backaussomethodeigenschaftenapplefindex 0 methodandroidtablets

Longtail Keyword Density for Testberichte.de

pfeilnavilinks back schliessen6
index 0 method4
0 method addhandleronclassname4
null else logmessagespushmessage4
if typeoflogger object4
tablets apple ipads4
apple ipads android-tablets4
0 null else4
pfeilnavilinks back6
back schliessen6
else logmessagespushmessage4
context selector4
0 method4
method addhandleronclassname4
null else4
index 04
typeoflogger object4
apple ipads4
ipads android-tablets4
0 null4
if typeoflogger4
tablets apple4
fr dich3

What are the nameservers for testberichte.de?

Testberichte.de Domain Nameserver Information

HostIP AddressCountry
ns1.testberichte.de Germany
ns10.schlundtech.de Germany

Testberichte.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Testberichte.de is a scam?