Apache2 Ubuntu Default Page: It works

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-03-13


Domain summary

Domain label
textlinkads
Domain extension
org
Domain registered:
2019-07-21
Domain updated:
2020-03-13
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is textlinkads.org ranked relative to other sites:

Percentage of visits to textlinkads.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Textlinkads.org registered?
A: Textlinkads.org was registered 1 year, 7 months, 1 week, 3 hours, 28 minutes, 40 seconds ago on Sunday, July 21, 2019.
Q: When was the WHOIS for Textlinkads.org last updated?
A: The WHOIS entry was last updated 11 months, 2 weeks, 1 day, 3 hours, 28 minutes, 40 seconds ago on Friday, March 13, 2020.
Q: What are Textlinkads.org's nameservers?
A: DNS for Textlinkads.org is provided by the following nameservers:
  • nsd1.srv53.org
  • nsa1.srv53.com
  • nsc1.srv53.net
  • nsa4.srv53.org
  • nsb4.srv53.org
  • nsc2.srv53.org
  • nsa2.srv53.net
  • nsd3.srv53.com
  • nsb2.srv53.net
  • nsc3.srv53.com
  • nsb3.srv53.com
  • nsd3.srv53.net
Q: Who is the registrar for the Textlinkads.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Textlinkads.org?
A: Textlinkads.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Textlinkads.org each day?
A: Textlinkads.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Textlinkads.org resolve to?
A: Textlinkads.org resolves to the IPv4 address 0.0.0.0.
Q: In what country are Textlinkads.org servers located in?
A: Textlinkads.org has servers located in the .
Q: What webserver software does Textlinkads.org use?
A: Textlinkads.org is powered by Apache/2.4.29 (Ubuntu) webserver.
Q: Who hosts Textlinkads.org?
A: Textlinkads.org is hosted by in .
Q: How much is Textlinkads.org worth?
A: Textlinkads.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Textlinkads.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Textlinkads.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Textlinkads.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Textlinkads.org

candocument rootconfwebnotyouapache2located confconfigurationweb serverdocumentyourdefaultpleasefilesdefault configurationrespectiveubuntuwhichfileserverifsiteconfiguration filesrootpage

Who hosts Textlinkads.org?

Textlinkads.org Hosting Provider Information

Hosted IP Address:0.0.0.0
Hosted Hostname:0.0.0.0
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache/2.4.29 (Ubuntu)

Is "" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
0.0070%

HTTP Header Analysis for Textlinkads.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Mar 2020 22:24:44 GMT
Server: Apache/2.4.29 (Ubuntu)
Last-Modified: Mon, 12 Aug 2019 21:36:41 GMT
ETag: "2aa6-58ff251d58a4e-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 3138
Content-Type: text/html

Textlinkads.org Domain Nameserver Information

HostIP AddressCountry
nsd1.srv53.org 89.184.64.93
nsa1.srv53.com 178.32.247.7
nsc1.srv53.net 77.88.202.227
nsa4.srv53.org 178.32.247.6
nsb4.srv53.org 148.251.31.59
nsc2.srv53.org 77.88.202.232
nsa2.srv53.net 178.32.247.0
nsd3.srv53.com 89.184.64.78
nsb2.srv53.net 148.251.31.48
nsc3.srv53.com 77.88.202.237
nsb3.srv53.com 148.251.31.53
nsd3.srv53.net 89.184.64.81


Need to find out who hosts Textlinkads.org?


Domain Registration (WhoIs) information for Textlinkads.org

 Domain Name: TEXTLINKADS.ORG
Registry Domain ID: D402200000010993210-LROR
Registrar WHOIS Server: whois.imena.ua
Registrar URL: http://www.imena.ua
Updated Date: 2019-09-20T03:45:40Z
Creation Date: 2019-07-21T14:43:41Z
Registry Expiry Date: 2020-07-21T14:43:41Z
Registrar Registration Expiration Date:
Registrar: Internet Invest, Ltd. dba Imena.ua
Registrar IANA ID: 1112
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +380.442010102
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Internet Invest, Ltd. dba Imena.ua
Registrant State/Province: Kyiv
Registrant Country: UA
Name Server: NSD1.SRV53.ORG
Name Server: NSA1.SRV53.COM
Name Server: NSC1.SRV53.NET
Name Server: NSA4.SRV53.ORG
Name Server: NSB4.SRV53.ORG
Name Server: NSC2.SRV53.ORG
Name Server: NSA2.SRV53.NET
Name Server: NSD3.SRV53.COM
Name Server: NSB2.SRV53.NET
Name Server: NSC3.SRV53.COM
Name Server: NSB3.SRV53.COM
Name Server: NSD3.SRV53.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-03-13T22:23:44Z

Websites with Similar Names

Textl.ink
TextL.ink - Share web links quickly and easily, with no effort!
Textla.app
Textla.com - Social domain name for sale
Textla.info
Textla.com - Social domain name for sale
Textla.org
Textla.com - Social domain name for sale
Textlaaddon.com
Textla.com - Social domain name for sale
Textlaaddons.com
Textla.com - Social domain name for sale
Textlab.app
Columbia TextLab

Recently Updated Websites

Provincial.wales (1 second ago.)Sagapure.org (3 seconds ago.)Coexisting.world (3 seconds ago.)Be-a-portable-oxygen-concentratorok.live (4 seconds ago.)Retinex.tech (5 seconds ago.)Blk2nature.yoga (6 seconds ago.)Alpedevero.top (6 seconds ago.)Digiwebsolutions.tech (8 seconds ago.)Aicemediastudiesdominick.social (9 seconds ago.)Depavision.info (9 seconds ago.)Rainfalldigital.org (11 seconds ago.)Suboxonenearme.org (11 seconds ago.)Behind.tools (11 seconds ago.)Truerunning.online (11 seconds ago.)Beizobeauty.zone (13 seconds ago.)Pulse.vodka (13 seconds ago.)Ksaisraeledb.org (15 seconds ago.)Iwearcutepieces.world (15 seconds ago.)Kayleens.world (16 seconds ago.)Grovelands.school (16 seconds ago.)Ceremya.website (17 seconds ago.)Uractifing.space (17 seconds ago.)Radsound.live (17 seconds ago.)Supplementsforever.store (17 seconds ago.)Mypetfood.store (18 seconds ago.)Dquanticw.top (19 seconds ago.)Wild-diabetes.org (19 seconds ago.)Neusoul.yoga (20 seconds ago.)Pakoherrera.space (21 seconds ago.)Rustin.store (22 seconds ago.)

Recently Searched Keywords

vv ramana murthy (2 seconds ago.)新型コロナウイルス感染拡大防止に向けた取り組み (3 seconds ago.)корпоративный портал «нлмк» подробнее (4 seconds ago.)nm trc (6 seconds ago.)tu the quan he lan dau (8 seconds ago.)2020 dec (11 seconds ago.)nineline (14 seconds ago.)find a blog (18 seconds ago.)book me a demo (27 seconds ago.)co v (32 seconds ago.)car rentals (42 seconds ago.)trung tâm hồng doan (44 seconds ago.)value else (52 seconds ago.)tiden (53 seconds ago.)about the bbc (57 seconds ago.)opacity 0-webkit-transform (59 seconds ago.)heparin (1 minute 2 seconds ago.)sync (1 minute 4 seconds ago.)invoice (1 minute 5 seconds ago.)japanese fuck (1 minute 6 seconds ago.)strategieslinktargetblanktypewixdatapageidc3xh1targetselftypepagelinkpagenamemarket (1 minute 7 seconds ago.)prompie 아카데미 (1 minute 9 seconds ago.)du lịch và ẩm thực (1 minute 9 seconds ago.)plus size clothing (1 minute 13 seconds ago.)forecast (1 minute 18 seconds ago.)the new leaders of the 21st century (1 minute 23 seconds ago.)our reopening (1 minute 31 seconds ago.)trung tu00e2m giu00fap (1 minute 33 seconds ago.)material safety data sheets (1 minute 36 seconds ago.)tomkho.com (1 minute 42 seconds ago.)