Thebikeshop.de Website Information

Thebikeshop.de has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 387,414, a Majestic Rank of 0, a Domain Authority of 25% and is not listed in DMOZ.

Thebikeshop.de is hosted by STRATO AG in Mecklenburg-vorpommern, Marsow, Germany, 19260.
Thebikeshop.de has an IP Address of 81.169.145.119 and a hostname of shop.strato.de.

The domain thebikeshop.de was registered 201 decades 8 years 9 months ago by , it was last modified 1 decade 2 years 7 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for thebikeshop.de

Full Whois Lookup for Thebikeshop.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: thebikeshop.de
Nserver: docks08.rzone.de
Nserver: shades13.rzone.de
Status: connect
Changed: 2011-10-06T06:22:24+02:00

[Tech-C]
Type: ROLE
Name: Hostmaster STRATO AG Webhosting
Organisation: STRATO AG
Address: Pascalstraße 10
PostalCode: 10587
City: Berlin
CountryCode: DE
Phone: +49 30886150
Fax: +49 3088615111
Email: Login to show email
2006-12-04T23:27:06+01:00

[Zone-C]
Type: ROLE
Name: Zonemaster STRATO AG Webhosting
Organisation: STRATO AG
Address: Pascalstraße 10
PostalCode: 10587
City: Berlin
CountryCode: DE
Phone: +49 30886150
Fax: +49 3088615111
Email: Login to show email
2006-12-05T00:35:07+01:00

Who hosts Thebikeshop.de?

Thebikeshop.de Web Server Information

Hosted IP Address:81.169.145.119
Hosted Hostname:shop.strato.de
Service Provider:STRATO AG
Hosted Country:GermanyDE
Location Latitude:53.4244
Location Longitude:10.9316
Webserver Software:Not Applicable

HTTP Header Analysis for Thebikeshop.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 29 Aug 2015 04:31:57 GMT
Server: Apache
Vary: Host,Accept-Encoding,User-Agent
Content-Language: de
X-AppServer: 192.168.42.187:11027
X-Powered-By: epages 6
X-Store: Store22
X-TimeAS: 1723
Content-Encoding: gzip
Content-Length: 18889
Connection: close
Content-Type: text/html; charset=utf-8


Need to find out who hosts Thebikeshop.de?

Thebikeshop.de Free SEO Report

Website Inpage Analysis for Thebikeshop.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Thebikeshop.de

requiredtargeturl gaqpushtracksocialtrinkflaschen0ready functionaluminium rennradall mountainparts und mavicparagraphsttelcross bikesversandfertiglieferfristcrossfirecontainsvorbaudtsofort versandfertiglieferfristvergleichen centurion10aluminium4 7 tage7rahmenhhe 54sofortlaufradsatzfunction varvergleichen centurion crossfirersaquo bianchishimano ultegrakomponenten und hydraulischenitalia2017 carbon rennrad11speed11speed partsmavic aksiumtwittercento10airoltrersaquocreategadgetselemuhrdi2gadgetelementc2ctruecannondale supersix evohelme47 tage vergleichencarbon rennradmountainbikes rsaquogclassname2017 rahmenhhe 54functionunverbindlichecustom11fachfacebooktage vergleichen meridalieferfrist 6eventlenkerbandclassbuttonversandfertiglieferfrist 47mountainbikesmountainbiketargeturl gaqpushtracksocial facebooksculturabianchi2017 centurion crossfiretrinkflaschen ampversandfertiglieferfrist 4 7crosstrail105 5800laufrderpedale2017 carbonclickpreisempfehlungtagelenker vorbau sattelsttzecannondale supersixmit shimano ultegraxclenker vorbaunbsp nbspgaqpushtracksocialshimanoevo ultegracannondalehydraulischen scheibenbremsenmit shimanoreplaceaksium4wilier cento10airdiscjet blackwiliermavicrennradesesrahmensetsampscheibenbremsen 2017frfr1craftversandfertiglieferfrist 47 tagerennrad mitblack2017 rahmenhhextc2c bianchirahmenhhevarparts15shimano xtslgfolder2017 centurionaddcyclo crossotherbuttonsbekleidungacidhydraulischen scheibenbremsen 2017supersix evohardtailwfunction targeturlultegra 6800carbon 2dedeultegra 6800 11speed14cross bikebikesparamsultegra 2017bottecchiaall11cycloevogadgets10 bis2017 abbikevergleichen cannondaleurlrennrderfully7 tagetargeturlsupersix evo ultegraultegraregion7 tage vergleichenmerida fullynbsp nbsp nbspswissmethanolcenturionmeridacolnago rennradvariantsdt swissmountainsantatage vergleichenhydraulischen11fach partsvergleichen meridajetsattelsttze10 tage vergleichenrennrad mit shimanobikes santadatasofort versandfertiglieferfrist 4versandfertiglieferfrist 4zubehrready2scheibenbremsencolnago rahmensetcolnagocustom variants810 tagelieferfrist 47cyclo cross bikevergleichenbislieferfrist 2tscaad12accessoriesshimano ultegra 6800gruppenfalsemitnbsp95rahmensetlieferfristcruzsanta cruzbikes wilierif6sofort versandfertiglieferfrist 47lieferfrist 47 tagemtbcenturion crossfireunverbindliche preisempfehlung3vergleichen cannondale supersix47 tagelenkersupersix47flaschenhalter6800 11speedfunction targeturl gaqpushtracksocialabtage vergleichen centurionrennrder rsaquo12underwearvorbau sattelsttzeenduro4 7function eventkomponenten13gtgaqpushtracksocial facebookshimano 105tage vergleichen cannondalebikes santa cruzcarboncannondale caad12

Longtail Keyword Density for Thebikeshop.de

KeywordsOccurences
mit shimano ultegra9
tage vergleichen cannondale8
cannondale supersix evo7
7 tage vergleichen7
shimano ultegra 68007
4-7 tage vergleichen6
tage vergleichen centurion5
vergleichen cannondale supersix5
parts und mavic5
4 7 tage5
sofort versandfertiglieferfrist 44
hydraulischen scheibenbremsen 20174
tage vergleichen merida4
nbsp nbsp nbsp4
cyclo cross bike3
2017 centurion crossfire3
ultegra 6800 11-speed3
function targeturl gaqpushtracksocial3
vergleichen centurion crossfire3
targeturl gaqpushtracksocial facebook3
10 tage vergleichen3
komponenten und hydraulischen3
rennrad mit shimano3
versandfertiglieferfrist 4 73
2017 rahmenhhe 543
bikes santa cruz3
supersix evo ultegra3
2017 carbon rennrad3
versandfertiglieferfrist 4-7 tage3
sofort versandfertiglieferfrist 4-73
lenker vorbau sattelsttze3
lieferfrist 4-7 tage3
tage vergleichen21
mit shimano13
ultegra 680010
nbsp nbsp9
shimano ultegra9
cannondale supersix9
santa cruz8
vergleichen cannondale8
7 tage7
unverbindliche preisempfehlung7
cyclo cross7
2017 rahmenhhe7
sofort versandfertiglieferfrist7
supersix evo7
rsaquo bianchi6
4-7 tage6
colnago rahmenset6
centurion crossfire6
carbon rennrad5
rennrder rsaquo5
4 75
hydraulischen scheibenbremsen5
rennrad mit5
colnago rennrad5
vergleichen centurion5
shimano 1055
scheibenbremsen 20174
lenker vorbau4
vergleichen merida4
lieferfrist 24
11-speed parts4
carbon 24
cross bikes4
versandfertiglieferfrist 44
wilier cento10air4
aluminium rennrad4
trinkflaschen amp4
merida fully4
mountainbikes rsaquo4
function event4
dt swiss4
mavic aksium4
gaqpushtracksocial facebook3
lieferfrist 63
shimano xt3
10 tage3
custom variants3
ultegra 20173
targeturl gaqpushtracksocial3
function var3
ready function3
2017 ab3
10 bis3
function targeturl3
6800 11-speed3
evo ultegra3
rahmenhhe 543
jet black3
bikes wilier3
bikes santa3
cannondale caad123
all mountain3
vorbau sattelsttze3
105 58003
lieferfrist 4-73
2017 centurion3
versandfertiglieferfrist 4-73
2017 carbon3
11-fach parts3
c2c bianchi3
cross bike3
cannondale40
rsaquo29
colnago28
bianchi27
026
carbon23
wilier23
vergleichen22
mit22
ultegra21
tage21
merida21
rennrad20
shimano20
centurion19
nbsp18
function17
var16
parts16
lieferfrist14
amp14
cross13
if13
lenkerband11
110
ab10
mavic10
bikes10
supersix10
rahmenset9
29
39
flaschenhalter9
trinkflaschen9
evo8
santa8
sttel8
rahmenhhe8
48
cruz8
disc8
komponenten7
versandfertiglieferfrist7
rennrder7
targeturl7
cyclo7
preisempfehlung7
facebook7
unverbindliche7
sofort7
true7
56
66
laufrder6
false6
76
helme6
twitter6
86
gaqpushtracksocial6
crossfire6
4-76
scheibenbremsen6
hardtail6
custom5
elem5
11-fach5
mountainbike5
11-speed5
hydraulischen5
95
event5
aluminium5
bekleidung5
trail5
mountain5
sattelsttze5
rahmensets5
caad125
vorbau5
zubehr5
lenker5
uhr4
bike4
eses4
add4
dede4
data4
gt4
bottecchia4
mountainbikes4
all4
click4
xc4
104
ready4
aksium4
laufradsatz4
otherbuttons4
black4
sl4
w4
variants4
swiss4
dt4
fully4
cento10air4
114
pedale4
gruppen4
contains3
replace3
gadget-element3
frfr3
params3
oltre3
ts3
c2c3
url3
classbutton3
paragraph3
region3
gadgets3
accessories3
underwear3
craft3
scultura3
italia3
mtb3
123
required3
jet3
acid3
133
enduro3
creategadgets3
gclassname3
gfolder3
143
bis3
di23
xt3
153
methanol3

What are the nameservers for thebikeshop.de?

Thebikeshop.de Domain Nameserver Information

HostIP AddressCountry
docks08.rzone.de 81.169.146.18Germany Germany
shades13.rzone.de 85.214.0.243Germany Germany

Thebikeshop.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Thebikeshop.de is a scam?