Thecabin.net  |  TheCabin.net - Conway, Arkansas
Low trust score  | 
Conway Arkansas, Faulkner County, Sports, Entertainment, Real Estate, Job Listings, Photos and Video. The Log Cabin Democrat is the number one source for Conway and Faulkner County News.

Thecabin.net Website Information

Thecabin.net has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 455,568, a Majestic Rank of 57,765, a Domain Authority of 66% and is not listed in DMOZ.

Thecabin.net is hosted by Morris Communications Corporation in Georgia, Augusta, United States, 30901.
Thecabin.net has an IP Address of 216.116.229.137 and a hostname of smssquid.groupz.net.

The domain thecabin.net was registered 2 decades 2 years 5 months ago by CSC CORPORATE DOMAINS, INC., it was last modified 4 years 2 months 1 week ago and currently is set to expire 2 years 5 months 3 weeks ago.


Whois information for thecabin.net

Full Whois Lookup for Thecabin.net Whois Lookup

Domain Name: THECABIN.NET
Registry Domain ID: 124097_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: http://www.cscglobal.com/global/web/csc/digital-brand-services.html
Updated Date: 2017-01-19T06:10:39Z
Creation Date: 1997-01-22T05:00:00Z
Registry Expiry Date: 2018-01-23T05:00:00Z
Registrar: CSC Corporate Domains, Inc.
Registrar IANA ID: 299
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 8887802723
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DUKE.GROUPZ.NET
Name Server: ZNET.GROUPZ.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-16T19:03:17Z

Who hosts Thecabin.net?

Thecabin.net Web Server Information

Hosted IP Address:216.116.229.137
Hosted Hostname:smssquid.groupz.net
Service Provider:Morris Communications Corporation
Hosted Country:United StatesUS
Location Latitude:33.4257
Location Longitude:-81.9611
Webserver Software:Not Applicable

HTTP Header Analysis for Thecabin.net

Http-Version: 1.0
Status-Code: 200
Status: 200 OK
Date: Fri, 21 Aug 2015 08:00:02 GMT
Server: Apache
X-Powered-By: PHP/5.2.10
X-Drupal-Cache: MISS
Expires: Fri, 21 Aug 2015 08:05:02 GMT
Last-Modified: Fri, 21 Aug 2015 08:00:02 0000
Cache-Control: must-revalidate, max-age=0, s-maxage=300
ETag: "1440144002"-gzip
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 22722
Content-Type: text/html; charset=utf-8
X-Cache: MISS from sms1.cac003.groupz.net
X-Cache-Lookup: MISS from sms1.cac003.groupz.net:3128
Connection: close


Need to find out who hosts Thecabin.net?

Thecabin.net Free SEO Report

Website Inpage Analysis for Thecabin.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Thecabin.net

googletag undefined synccookievaluestorage undefined vartargetingparameters jsonparsetargetingparamstr setundefined taxonomy drupalsettingstealiumsectionspmenubottom btnstyleactivefocus728 90margintopbordercoloriftypeof googletag undefined0 bc targetingparameterslengthundefined ctype drupalsettingstealiumctypevar ctypetypeof drupalsettingstealium undefinedbolducablocksettargetingccaudnmtaudstaxonomyyiftypeoftypeof storage undefineddeclare anydisplaydrupalsettingstealium undefined taxonomynpagelevel targetingvar targetingparamstrsettargetingtaxonomy taxonomy settargetingpplogintrue synccookievalue006699court arkansasslotsgoogletag undefinedtargetingparameterslength bcstoragefloatviloniagoogletagany slots initiallyallsynccookievalue n varopen dropdowntogglepmenubottomanytaxonomy googletagcmdpushfunction declaresetcollapseemptydivfalse settargetingccaudnmtaudssynccookievaluefrankelseif typeof drupalsettingstealiumplanned parenthood money5ctype drupalsettingstealiumctype elseyestypeof drupalsettingstealiumbc 0 bcbuildsetcollapseemptydivfalsepage view001e13var bc 0googletagdefineslotnmtdataadsdfpadunitprefixeatwindowgoogletagpubadssettargetingparamkeysearchcourtclassifiedstargetingparamstr varsettargetingpplogintargetingparametersbc windowgoogletagpubadssettargetingparamkey paramvaluedisplay to registerdrupalsettingstealiumctype elseundefined synccookievaluesettargetingcontenttype ctypemoretaxonomy if typeof3parameters for varwindowgoogletagpubadssettargetingparamkey paramvaluecancan block planneddrupalsettingstealium undefinedbuild settargetingccaudnmtaudsimportantinitially presentbcsynccookievalue ifjquerycookiesyncwallactivesubscriber true0 bcctype settargetingtaxonomytaxonomy settargetingpploginctype varsettargetingcontenttypeready and refreshdefinesizemappinggoogletagsizemappingparenthood moneysyncallow yesslots initiallycall displayif targetingparamstr varnbspfloat right margintopn var ctypegoogletagenableservicestue4px 4pxsettargetingccaudnmtauds settargetingcccenablefetchifjquerycookiesyncwallactivesubscriber truediesinherit importantparamvalue googletagpubadsenablesinglerequest googletagenableservicesmarisavalueundefined synccookievalue nsynccookievalue ifjquerycookiesyncwallactivesubscribertargeting parametersautossynccookievalue nvar synccookievalue ifjquerycookiesyncwallactivesubscribercallparametersbtnstylefocusmarisa hicksfontweight boldrightn varifjquerycookiesyncwallactivesubscriber true googletagcmdpushfunctionarkansas can blocklocalstoragegetitembcdfptargetingparamsset pagelevelcookiegoogletagcmdpushfunction declarevar bcbc targetingparameterslengthjobframevarrefreshtargetingparamstr var targetingparametersiftypeof googletagadserviceselse synccookievalue nnmtdataadsdfpadunit 300synccookievalue setcollapseemptydivfalse settargetingccaudnmtaudssetcollapseemptydivfalse settargetingccaudnmtauds settargetingccc081217settargetingpplogin synccookievaluedrupalsettingstealiumsectionsnone08152017if typeof storagebestsettargetingcccenable servicesdrupalsettingstealium undefined ctypefloat rightgoogletagdefineslotnmtdataadsdfpadunitprefix nmtdataadsdfpadunit 3001googletagpubadsenablesinglerequest googletagenableservicesgoogletagpubadsenablesinglerequestsynccookievalue n iftypeofsettargetingcontenttype ctype settargetingtaxonomycircularmorelinkultargetingparametersnobtnstyleactivefocuselse ctypemoneyvar targetingparameterstargetingparameterslength bc varundefined taxonomyfontweighttue 08152017federalgoogletagcmdpushfunctionhickstypeofservices ifjquerycookiesyncwallactivesubscriberbc vardropdowntogglepmenubottomsetfetch an ad10pxparenthoody elseelse taxonomy googletagcmdpushfunctionctype drupalsettingstealiumctypeentertainmenttargetingparametersbc windowgoogletagpubadssettargetingparamkeyconwayvar ctype varsportssettargetingtaxonomy taxonomybackgroundcolor 006699federal courtvar synccookievaluesalesdrupalsettingstealiumctypesettargetingposvar param targetingparametersbcparam targetingparametersbcundefined vardeclare any slotsinheritsubmitbc var paramslot as readyarkansas cantaxonomy settargetingpplogin synccookievaluebc targetingparameterslength bcrefresh to fetchcan blockstorage undefinedcolorgoogletagpubadsenablesinglerequest googletagenableservices enabletargetinggoogletagenableservices enable servicessynccookievalue y elsejobsholderjsonparsetargetingparamstr set pagelevelsettargetingccaudnmtauds settargetingccc nmtdataadsdfpccc4px4px 4px 4pxenable services ifjquerycookiesyncwallactivesubscribertargetingparamstr localstoragegetitembcdfptargetingparams ifvar paramtargetingparameterslengthtaxonomy ifbackgroundcolorsynchistlenjobsfontsizejobswidgetwrappergoogletagcmdpushfunction declare anyif typeofopenelse ctype iftruedrupalsettingstealiumsections else taxonomy6pagelevel targeting parameters0broylesregistersettargetingccc nmtdataadsdfpccc ifany slotscourt arkansas canbc 0drupalsettingstealiumlocalwidgeteaglesfontfamilynbsp 08162017paramvalue googletagpubadsenablesinglerequestparamreadynmtdataadsdfpccc if typeofsynccookievalue yresidentsctype ifundefinednmtdataadsdfpccctaxonomy drupalsettingstealiumsections elsevar taxonomy ifgoogletagdefineslotnmtdataadsdfpadunitprefix nmtdataadsdfpadunitlocalstoragegetitembcdfptargetingparams ifvar syncallowpagewidthpage varfaulkner countyregister the slotdrupalsettingstealiumctype else ctypearkansaspmenubottomblock plannednmtdataadsdfpadunitsyncallowinitiallyn iftypeoftargetingparamstr localstoragegetitembcdfptargetingparamsplannedlocalstoragegetitembcdfptargetingparams if targetingparamstrfrank broylestrue synccookievalue ygoogletagenableservices enabley else synccookievaluectype if typeoftypeof storagectypeblock planned parenthoodcountyundefined var targetingparamstrparam targetingparametersbc windowgoogletagpubadssettargetingparamkeyparamvaluepresent2slots initially presenteat it conwayaddservicegoogletagpubadspadding 4pxsettargetingtaxonomynews08162017settargetingpplogin synccookievalue setcollapseemptydivfalsejsonparsetargetingparamstr setundefined ctypesettargetingccc nmtdataadsdfpcccvar targetingparameters jsonparsetargetingparamstrfaulknerplanned parenthood006699 importantvar taxonomyad googletagcmdpushfunctionifjquerycookiesyncwallactivesubscriber true synccookievaluevar targetingparamstr localstoragegetitembcdfptargetingparamstargetingparamstrslotifsynccookievalue setcollapseemptydivfalseservices ifjquerycookiesyncwallactivesubscriber trueif targetingparamstrdrupalsettingstealiumsections elsefederal court arkansaspaddingtargetingparameters jsonparsetargetingparamstrset pagelevel targetingjobframe jobsholderjsonparsetargetingparamstrmarginbottom5pxnmtdataadsdfpccc ifright margintopbordercolor 006699taxonomy googletagcmdpushfunctionctype var taxonomytargetingparametersbcwidth 100declaretaxonomy drupalsettingstealiumsectionsphotosn iftypeof googletagaddsize0 0pagelevel4addservicegoogletagpubads settargetingposctype settargetingtaxonomy taxonomywhitedisplay blockifjquerycookiesyncwallactivesubscriberviewlocalelse taxonomytrue googletagcmdpushfunctionelse synccookievalueaddsize0windowgoogletagpubadssettargetingparamkey paramvalue googletagpubadsenablesinglerequest

Longtail Keyword Density for Thecabin.net

KeywordsOccurences
typeof drupalsettingstealium undefined14
if typeof drupalsettingstealium14
ctype settargetingtaxonomy taxonomy8
settargetingtaxonomy taxonomy settargetingpplogin8
slots initially present8
declare any slots8
googletagcmdpushfunction declare any8
taxonomy settargetingpplogin synccookievalue8
any slots initially8
settargetingcontenttype ctype settargetingtaxonomy8
var synccookievalue ifjquerycookiesyncwall-active-subscriber8
ifjquerycookiesyncwall-active-subscriber true synccookievalue8
synccookievalue ifjquerycookiesyncwall-active-subscriber true8
true synccookievalue y8
synccookievalue y else8
y else synccookievalue8
else synccookievalue n8
localstoragegetitembcdfptargetingparams if targetingparamstr7
targetingparamstr var targetingparameters7
if targetingparamstr var7
targetingparamstr localstoragegetitembcdfptargetingparams if7
undefined var targetingparamstr7
typeof storage undefined7
var targetingparameters jsonparsetargetingparamstr7
var targetingparamstr localstoragegetitembcdfptargetingparams7
parameters for var7
var param targetingparametersbc7
bc var param7
targetingparameterslength bc var7
param targetingparametersbc windowgoogletagpubadssettargetingparamkey7
targetingparametersbc windowgoogletagpubadssettargetingparamkey paramvalue7
paramvalue googletagpubadsenablesinglerequest googletagenableservices7
windowgoogletagpubadssettargetingparamkey paramvalue googletagpubadsenablesinglerequest7
bc targetingparameterslength bc7
0 bc targetingparameterslength7
set page-level targeting7
jsonparsetargetingparamstr set page-level7
page-level targeting parameters7
if typeof storage7
bc 0 bc7
var bc 07
targetingparameters jsonparsetargetingparamstr set7
storage undefined var7
drupalsettingstealium undefined ctype7
undefined ctype drupalsettingstealiumctype7
ctype drupalsettingstealiumctype else7
drupalsettingstealiumctype else ctype7
taxonomy if typeof7
var taxonomy if7
synccookievalue n iftypeof7
n iftypeof googletag7
var ctype var7
ctype var taxonomy7
else ctype if7
iftypeof googletag undefined7
taxonomy googletagcmdpushfunction declare7
ctype if typeof7
drupalsettingstealiumsections else taxonomy7
else taxonomy googletagcmdpushfunction7
taxonomy drupalsettingstealiumsections else7
undefined taxonomy drupalsettingstealiumsections7
drupalsettingstealium undefined taxonomy7
nmtdataadsdfpccc if typeof6
settargetingccaudnmtauds settargetingccc nmtdataadsdfpccc6
settargetingccc nmtdataadsdfpccc if6
googletag undefined synccookievalue6
settargetingpplogin synccookievalue setcollapseemptydivfalse6
undefined synccookievalue n6
synccookievalue n var6
googletagenableservices enable services5
ifjquerycookiesyncwall-active-subscriber true googletagcmdpushfunction5
googletagpubadsenablesinglerequest googletagenableservices enable5
n var ctype5
ready and refresh4
refresh to fetch4
fetch an ad4
4px 4px 4px4
eat it conway4
slot as ready4
register the slot4
setcollapseemptydivfalse settargetingccaudnmtauds settargetingccc4
synccookievalue setcollapseemptydivfalse settargetingccaudnmtauds4
display to register4
block planned parenthood3
planned parenthood money3
googletagdefineslotnmtdataadsdfpadunitprefix nmtdataadsdfpadunit 3003
can block planned3
services ifjquerycookiesyncwall-active-subscriber true3
enable services ifjquerycookiesyncwall-active-subscriber3
float right margin-top3
federal court arkansas3
court arkansas can3
arkansas can block3
if typeof23
drupalsettingstealium undefined14
synccookievalue n14
ifjquerycookiesyncwall-active-subscriber true14
typeof drupalsettingstealium14
undefined var9
settargetingcontenttype ctype8
ctype settargetingtaxonomy8
var synccookievalue8
declare any8
any slots8
slots initially8
initially present8
settargetingtaxonomy taxonomy8
taxonomy settargetingpplogin8
googletagcmdpushfunction declare8
synccookievalue y8
else synccookievalue8
googletagpubadsenablesinglerequest googletagenableservices8
true synccookievalue8
settargetingpplogin synccookievalue8
synccookievalue ifjquerycookiesyncwall-active-subscriber8
googletag undefined8
y else8
targetingparamstr localstoragegetitembcdfptargetingparams7
var targetingparamstr7
storage undefined7
localstoragegetitembcdfptargetingparams if7
targetingparamstr var7
var bc7
var param7
bc var7
targetingparameterslength bc7
param targetingparametersbc7
targetingparametersbc windowgoogletagpubadssettargetingparamkey7
paramvalue googletagpubadsenablesinglerequest7
windowgoogletagpubadssettargetingparamkey paramvalue7
bc targetingparameterslength7
0 bc7
set page-level7
jsonparsetargetingparamstr set7
targetingparameters jsonparsetargetingparamstr7
page-level targeting7
targeting parameters7
bc 07
typeof storage7
var targetingparameters7
if targetingparamstr7
ctype drupalsettingstealiumctype7
undefined ctype7
else ctype7
ctype if7
undefined taxonomy7
taxonomy if7
var taxonomy7
n iftypeof7
iftypeof googletag7
var ctype7
ctype var7
taxonomy drupalsettingstealiumsections7
drupalsettingstealiumctype else7
drupalsettingstealiumsections else7
googletagdefineslotnmtdataadsdfpadunitprefix nmtdataadsdfpadunit7
addservicegoogletagpubads settargetingpos7
else taxonomy7
taxonomy googletagcmdpushfunction7
n var6
undefined synccookievalue6
settargetingccaudnmtauds settargetingccc6
nmtdataadsdfpccc if6
synccookievalue setcollapseemptydivfalse6
faulkner county6
4px 4px6
settargetingccc nmtdataadsdfpccc6
true googletagcmdpushfunction5
enable services5
jobframe jobsholder5
page var5
googletagenableservices enable5
006699 important4
inherit important4
padding 4px4
nbsp 081620174
setcollapseemptydivfalse settargetingccaudnmtauds4
call display4
728 904
frank broyles3
marisa hicks3
tue 081520173
parenthood money3
nmtdataadsdfpadunit 3003
width 1003
syncallow yes3
page view3
var syncallow3
build settargetingccaudnmtauds3
addsize0 03
font-weight bold3
planned parenthood3
block planned3
open dropdown-togglepmenu-bottom3
pmenu-bottom btnstyleactivefocus3
background-color 0066993
display block3
right margin-top3
ad googletagcmdpushfunction3
border-color 0066993
arkansas can3
can block3
court arkansas3
federal court3
services ifjquerycookiesyncwall-active-subscriber3
float right3
var61
synccookievalue38
if32
undefined31
ctype29
taxonomy29
else26
typeof23
bc21
page16
googletagcmdpushfunction16
n15
targetingparamstr14
important14
drupalsettingstealium14
true14
ifjquerycookiesyncwall-active-subscriber14
013
conway13
4px11
nbsp10
more9
arkansas9
synchistlen9
present9
googletag8
any8
slots8
initially8
set8
googletagpubadsenablesinglerequest8
declare8
googletagenableservices8
0066998
y8
color8
settargetingcontenttype8
addservicegoogletagpubads8
nmtdataadsdfpadunit8
pmenu-bottom8
settargetingtaxonomy8
settargetingpplogin8
windowgoogletagpubadssettargetingparamkey7
param7
paramvalue7
targetingparametersbc7
iftypeof7
county7
display7
jobframe7
targetingparameterslength7
syncallow7
drupalsettingstealiumctype7
background-color7
parameters7
settargetingccaudnmtauds7
localstoragegetitembcdfptargetingparams7
settargetingpos7
storage7
drupalsettingstealiumsections7
targetingparameters7
googletagdefineslotnmtdataadsdfpadunitprefix7
targeting7
page-level7
jsonparsetargetingparamstr7
setcollapseemptydivfalse7
padding6
16
block6
faulkner6
081620176
news6
margin-bottom6
jobswidgetwrapper6
settargetingccc6
nmtdataadsdfpccc6
font-size6
none5
width5
border-color5
eat5
services5
call5
local-widget5
25
enable5
value5
jobsholder5
local5
slot4
no4
view4
font-family4
34
44
photos4
cookie4
54
jobs4
inherit4
64
white4
yes4
circularmorelink4
ad4
fetch4
ready4
refresh4
float4
register4
sports4
search4
margin-top4
frank3
hicks3
marisa3
5px3
broyles3
0812173
ul3
font-weight3
081520173
best3
bold3
dies3
eagles3
sales3
vilonia3
all3
right3
001e133
uca3
entertainment3
addsize03
definesizemappinggoogletagsizemapping3
build3
classifieds3
autos3
10px3
open3
planned3
can3
parenthood3
money3
submit3
court3
federal3
dropdown-togglepmenu-bottom3
btnstyleactivefocus3
btnstylefocus3
residents3
tue3

What are the nameservers for thecabin.net?

Thecabin.net Domain Nameserver Information

HostIP AddressCountry
duke.groupz.net 216.116.243.133United States United States
znet.groupz.net 216.116.230.12United States United States

Thecabin.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Thecabin.net is a scam?