Thecashshop.net

Website Thumbnail
Checking...
Pawnbroking and Gold Buying | Cash Shop

Safety: Low trust score
Year Founded: 2005
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-24
Category: This site has not been categorized yet


Domain summary

Domain label
thecashshop
Domain extension
net
Domain registered:
2005-12-02
Domain updated:
2019-11-01
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is thecashshop.net ranked relative to other sites:

Percentage of visits to thecashshop.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Thecashshop.net registered?
A: Thecashshop.net was registered 14 years, 11 months, 4 weeks, 19 hours, 26 minutes, 19 seconds ago on Friday, December 2, 2005.
Q: When was the WHOIS for Thecashshop.net last updated?
A: The WHOIS entry was last updated 1 year, 4 weeks, 1 day, 19 hours, 26 minutes, 19 seconds ago on Friday, November 1, 2019.
Q: What are Thecashshop.net's nameservers?
A: DNS for Thecashshop.net is provided by the following nameservers:
  • ns1.dreamhost.com
  • ns2.dreamhost.com
  • ns3.dreamhost.com
Q: Who is the registrar for the Thecashshop.net domain?
A: The domain has been registered at DREAMHOST, LLC.
Q: What is the traffic rank for Thecashshop.net?
A: Thecashshop.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Thecashshop.net each day?
A: Thecashshop.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Thecashshop.net resolve to?
A: Thecashshop.net resolves to the IPv4 address 173.236.176.89.
Q: In what country are Thecashshop.net servers located in?
A: Thecashshop.net has servers located in the United States.
Q: What webserver software does Thecashshop.net use?
A: Thecashshop.net is powered by Apache webserver.
Q: Who hosts Thecashshop.net?
A: Thecashshop.net is hosted by New Dream Network, LLC in California, Brea, United States, 92821.
Q: How much is Thecashshop.net worth?
A: Thecashshop.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Thecashshop.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Thecashshop.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Thecashshop.net

H1 Headings

1 :
  1. THE GOVERNMENT HAS DEEMED SHORT-TERM LENDERS TO BE AN ESSENTIAL SERVICE

H2 Headings

3 :
  1. Want to know more?
  2. Get A Quote
  3. Send Us A Message

H3 Headings

2 :
  1. Cash Shop - Fast, Friendly and Fair!
  2. Trade Associations

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-4564967-16

Links - Internal

66:
  1. http://thecashshop.net/
    http://thecashshop.net/
  2. http://thecashshop.net/find-a-store/
    http://thecashshop.net/find-a-store/
  3. Thecashshop Get A Quote
    http://thecashshop.net/get-a-quote
  4. Thecashshop Services
    http://thecashshop.net/services
  5. Thecashshop Pawnbroking
    http://thecashshop.net/pawnbroking
  6. Thecashshop Pawn By Post
    http://thecashshop.net/pawn-by-post
  7. Thecashshop We Buy Gold
    http://thecashshop.net/we-buy-gold
  8. Thecashshop Sell Your Goods
    http://thecashshop.net/sell-your-goods
  9. Thecashshop Buy Back Service
    http://thecashshop.net/buy-back-service
  10. Thecashshop Cheque Cashing
    http://thecashshop.net/cheque-cashing
  11. Thecashshop Foreign Currency
    http://thecashshop.net/foreign-currency
  12. Thecashshop Money Transfer
    http://thecashshop.net/money-transfer
  13. Thecashshop Retail Bargains
    http://thecashshop.net/retail-bargains
  14. Thecashshop Get a Quote
    http://thecashshop.net/quote
  15. Thecashshop About Us
    http://thecashshop.net/about-us
  16. Thecashshop Find A Store
    http://thecashshop.net/find-a-store
  17. Thecashshop Jobs
    http://thecashshop.net/jobs
  18. Thecashshop Latest News
    http://thecashshop.net/news
  19. Thecashshop Complaints Procedure
    http://thecashshop.net/complaints-procedure
  20. Thecashshop Privacy Policy
    http://thecashshop.net/privacy-policy
  21. Thecashshop Cookie Policy
    http://thecashshop.net/cookie-policy
  22. Thecashshop Money In A Hurry
    http://thecashshop.net/money-in-a-hurry
  23. Thecashshop Contact Us
    http://thecashshop.net/contact-us
  24. Thecashshop Find A Store
    http://thecashshop.net/?searchagain=true
  25. Thecashshop COVID-19
    http://thecashshop.net/covid-19
  26. Thecashshop BuyBack Service
    http://thecashshop.net/buy-back-service
  27. Thecashshop We Buy Gold
    http://thecashshop.net/we-buy-gold.php
  28. Thecashshop We Buy Used Goods
    http://thecashshop.net/sell-your-goods
  29. Thecashshop Foreign Currency Exchange
    http://thecashshop.net/foreign-currency
  30. Thecashshop Quality, Pre-Owned Goods For Sale
    http://thecashshop.net/retail-bargains
  31. Thecashshop Find A Store Near You
    http://thecashshop.net/find-a-store
  32. Thecashshop Overview
    http://thecashshop.net/pawnbroking
  33. Thecashshop Gold, Silver & Platinum
    http://thecashshop.net/pawn-gold-silver-platinum
  34. Thecashshop Jewellery
    http://thecashshop.net/pawn-jewellery
  35. Thecashshop Watches
    http://thecashshop.net/pawn-watches
  36. Thecashshop Coins
    http://thecashshop.net/sell-coins
  37. Thecashshop Overview
    http://thecashshop.net/sell-your-goods
  38. Thecashshop Mobile Phones
    http://thecashshop.net/sell-mobile-phones
  39. Thecashshop Jewellery & Watches
    http://thecashshop.net/sell-jewellery-watches
  40. Thecashshop Guitars & Musical Instruments
    http://thecashshop.net/sell-guitars-musical-instruments
  41. Thecashshop Consoles & Video Games
    http://thecashshop.net/sell-consoles-video-games
  42. Thecashshop TVs & Blu-ray Players
    http://thecashshop.net/sell-tvs-blu-ray-players
  43. Thecashshop Sat Navs
    http://thecashshop.net/sell-sat-navs
  44. Thecashshop Cameras
    http://thecashshop.net/sell-cameras
  45. Thecashshop Laptops & Tablets
    http://thecashshop.net/sell-laptops-tablets
  46. Thecashshop iPods and Media Players
    http://thecashshop.net/sell-ipods-and-media-players
  47. Thecashshop Overview
    http://thecashshop.net/buy-back-service
  48. Thecashshop Laptops
    http://thecashshop.net/buy-back-laptops
  49. Thecashshop Mobile Phones
    http://thecashshop.net/buy-back-mobile-phones
  50. Thecashshop Consoles and Video Games
    http://thecashshop.net/buyback-consoles-and-video-games
  51. Thecashshop TVs and Blu-ray Players
    http://thecashshop.net/buy-back-tvs-and-blu-ray-players
  52. Thecashshop Musical Instruments
    http://thecashshop.net/buy-back-musical-instruments
  53. Thecashshop Tablets
    http://thecashshop.net/buyback-tablets
  54. Thecashshop Cameras
    http://thecashshop.net/buy-back-cameras
  55. Thecashshop iPods and Media Players
    http://thecashshop.net/buy-back-ipods-and-media-players
  56. Thecashshop the UK
    http://thecashshop.net/?reset=true
  57. Thecashshop Nottingham
    http://thecashshop.net/in/nottingham
  58. Thecashshop Bulwell
    http://thecashshop.net/in/bulwell
  59. Thecashshop Leicester
    http://thecashshop.net/in/leicester
  60. Thecashshop Hull
    http://thecashshop.net/in/hull
  61. Thecashshop Leeds
    http://thecashshop.net/in/leeds
  62. Thecashshop Doncaster
    http://thecashshop.net/in/doncaster
  63. Thecashshop Sheffield
    http://thecashshop.net/in/sheffield
  64. Thecashshop Peterborough
    http://thecashshop.net/in/peterborough
  65. Thecashshop Rotherham
    http://thecashshop.net/in/rotherham
  66. Thecashshop Bilston
    http://thecashshop.net/in/bilston

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Thecashshop.net

if youbestcashcurrencymodal1451money transfernocheque cashingmodal1451hidesendpolicymediahavejewellerywant0ampforeignstoresend usforeign currencyourfinancialservicesmessagepawnmodal280watcheswe buy goldfriendly and fairvideooverviewfindgoodshideintromodalyou needyourfind a storeyour goodsvarfunction hideintromodalretailsetupoutromodalgoldvisitfairbuypostcash shopcashingknowmoneypawnbrokingweusnameyouus a messagepawn by postserviceassociationbuy goldshopfast friendlyoutwebsitetruebackifboxmenutoplevellilastchildfastplayersquotegetwe buyget a quotefriendlytransferchequefunctionnumberneed

Who hosts Thecashshop.net?

Thecashshop.net Hosting Provider Information

Hosted IP Address:173.236.176.89
Hosted Hostname:apache2-cabo.diamond.dreamhost.com
Service Provider:New Dream Network, LLC
Hosted Country:United StatesUS
Location Latitude:33.9339
Location Longitude:-117.8854
Webserver Software:Apache

Is "New Dream Network, LLC" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
New Dream Network, LLC
0.6728%

HTTP Header Analysis for Thecashshop.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 24 Oct 2020 20:53:42 GMT
Server: Apache
Location: https://thecashshop.net/
Cache-Control: max-age=2592000
Expires: Mon, 23 Nov 2020 20:53:42 GMT
Content-Length: 232
Content-Type: text/html; charset=iso-8859-1

Thecashshop.net Domain Nameserver Information

HostIP AddressCountry
ns1.dreamhost.com 162.159.26.24
ns2.dreamhost.com 162.159.27.142
ns3.dreamhost.com 162.159.26.24


Need to find out who hosts Thecashshop.net?


Domain Registration (WhoIs) information for Thecashshop.net

 Domain Name: thecashshop.net
Registry Domain ID: 273361156_DOMAIN_NET-VRSN
Registrar WHOIS Server: WHOIS.DREAMHOST.COM
Registrar URL: WWW.DREAMHOST.COM
Updated Date: 2019-11-01T07:31:34.00Z
Creation Date: 2005-12-02T12:33:00.00Z
Registrar Registration Expiration Date: 2020-12-02T12:33:23.00Z
Registrar: DREAMHOST
Registrar IANA ID: 431
Domain Status: ok https://www.icann.org/epp#ok
Registrant Name: Proxy Protection LLC
Registrant Organization: Proxy Protection LLC
Registrant Street: 417 Associated Rd #324
Registrant Street: C/O thecashshop.net
Registrant City: Brea
Registrant State/Province: CA
Registrant Postal Code: 92821
Registrant Country: US
Registrant Phone: +1.7147064182
Registrant Phone Ext:
Registrant Fax:
Registrant Email: Login to show email
Name: Proxy Protection LLC
Admin Organization: Proxy Protection LLC
Admin Street: 417 Associated Rd #324
Admin Street: C/O thecashshop.net
Admin City: Brea
Admin State/Province: CA
Admin Postal Code: 92821
Admin Country: US
Admin Phone: +1.7147064182
Admin Phone Ext:
Admin Fax:
Admin Email: Login to show email
Name: Proxy Protection LLC
Tech Organization: Proxy Protection LLC
Tech Street: 417 Associated Rd #324
Tech Street: C/O thecashshop.net
Tech City: Brea
Tech State/Province: CA
Tech Postal Code: 92821
Tech Country: US
Tech Phone: +1.7147064182
Tech Phone Ext:
Tech Fax:
Tech Email: Login to show email
Server: NS1.DREAMHOST.COM
Name Server: NS2.DREAMHOST.COM
Name Server: NS3.DREAMHOST.COM
DNSSEC: unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2132719359
URL of the ICANN WHOIS Data Problem Reporting System: HTTP://WDPRS.INTERNIC.NET/
>>> Last update of WHOIS database: 2020-08-24T15:44:26.00Z

Websites with Similar Names

Thecaa.org
Welcome to The Club for Acts and Actors ~ The C.A.A. London WC2E
Thecaalblog.com
CAAL Blog – Beauty Health & Styling tips
Thecaapp.com
thecaapp.com Is for Sale
Thecaasc.com
Buy a Domain Name - World's Best Domains For Sale

Recently Updated Websites

Nepalquest.com (2 seconds ago.)Mbitesgrill.com (3 seconds ago.)Megabash2020.com (4 seconds ago.)Negotiationtherapy.com (6 seconds ago.)Niceforu24h.com (8 seconds ago.)Mammothipfund.com (8 seconds ago.)National---championship.com (10 seconds ago.)Mytripitaly.com (10 seconds ago.)Unadere.pro (11 seconds ago.)Ntzjb.com (13 seconds ago.)Marinaethadeu.com (14 seconds ago.)Nikubarunioku.com (15 seconds ago.)Ndpforu.com (16 seconds ago.)Devonptsdsurvivors.online (16 seconds ago.)Nielslaan.com (17 seconds ago.)Nguyendanggiap.com (18 seconds ago.)Stonedkiwi.online (20 seconds ago.)Nepalcomputers.com (22 seconds ago.)Carlosruizb.online (26 seconds ago.)Lznbw.com (27 seconds ago.)Maxmonintl.com (28 seconds ago.)Nauyju.com (28 seconds ago.)Nkitpaintball.com (28 seconds ago.)Nfcchampionship--game.com (29 seconds ago.)Eventsatmanchester.com (29 seconds ago.)Ultimatex.shop (30 seconds ago.)Mediatanpabatas.com (32 seconds ago.)Mymulberi.com (32 seconds ago.)Mbaktoto.com (36 seconds ago.)Nice-hotels-travel.com (38 seconds ago.)

Recently Searched Keywords

centrifuga.hu (1 second ago.)net 1123 (1 second ago.)ketoxp keto boost weight loss formula (1 second ago.)38068buxton (1 second ago.)conveyor (1 second ago.)sokig (2 seconds ago.)blizu korena (2 seconds ago.)pronto.hu (2 seconds ago.)ajanlolevel.hu (2 seconds ago.)cigars.hu (2 seconds ago.)stvarate irok (3 seconds ago.)corporation.hu (3 seconds ago.)mák (3 seconds ago.)finom kzztve (3 seconds ago.)mutasdmeg.hu (3 seconds ago.)kakaópor (3 seconds ago.)8211 till (4 seconds ago.)till death (4 seconds ago.)nyúl recept (4 seconds ago.)mimosa (4 seconds ago.)by nanda oliveira (5 seconds ago.)cssze (5 seconds ago.)ksztek (5 seconds ago.)files 024 (5 seconds ago.)vam da sami (6 seconds ago.)stilova (6 seconds ago.)narancslé (6 seconds ago.)boseg.hu (6 seconds ago.)case 22 fatal attraction.  (6 seconds ago.)taptalaj.hu (7 seconds ago.)