News, sport and opinion from the Guardian's UK edition | The Guardian

Safety: High trust score
Year Founded: 1994
Global Traffic Rank: 79
Estimated Worth: $218,334,960

Latest news, sport, business, comment, analysis and reviews from the Guardian, the world's leading liberal voice



Domain summary

Last updated
2020-10-30
Domain label
theguardian
Domain extension
com
Domain registered:
1994-07-06
Domain updated:
2017-07-05
Global Traffic Rank
79
Statvoo Rating
A+
Trust Score
High trust score
Estimated worth
$218,334,960
Estimated daily income
$202,162
Estimated monthly income
$6,149,094

Rank summary

How is theguardian.com ranked relative to other sites:

Percentage of visits to theguardian.com from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Theguardian.com registered?
A: Theguardian.com was registered 26 years, 9 months, 5 days, 10 hours, 14 minutes, 47 seconds ago on Wednesday, July 6, 1994.
Q: When was the WHOIS for Theguardian.com last updated?
A: The WHOIS entry was last updated 3 years, 9 months, 6 days, 10 hours, 14 minutes, 47 seconds ago on Wednesday, July 5, 2017.
Q: What are Theguardian.com's nameservers?
A: DNS for Theguardian.com is provided by the following nameservers:
  • dns1.p04.nsone.net
  • dns2.p04.nsone.net
  • dns3.p04.nsone.net
  • dns4.p04.nsone.net
  • ns01.theguardiandns.com
  • ns02.theguardiandns.com
  • ns03.theguardiandns.com
  • ns04.theguardiandns.com
Q: Who is the registrar for the Theguardian.com domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Theguardian.com?
A: Theguardian.com ranks 79 globally on Alexa. Theguardian.com has a High trust score, and a Statvoo Rank of A+.
Q: How many people visit Theguardian.com each day?
A: Theguardian.com receives approximately 25,270,270 visitors and 202,162,160 page impressions per day.
Q: What IP address does Theguardian.com resolve to?
A: Theguardian.com resolves to the IPv4 address 151.101.1.111.
Q: In what country are Theguardian.com servers located in?
A: Theguardian.com has servers located in the United States.
Q: What webserver software does Theguardian.com use?
A: Theguardian.com is powered by Varnish webserver.
Q: Who hosts Theguardian.com?
A: Theguardian.com is hosted by Consortium GARR in United States.
Q: How much is Theguardian.com worth?
A: Theguardian.com has an estimated worth of $218,334,960. An average daily income of approximately $202,162, which is roughly $6,149,094 per month.

Theguardian.com Reviews

We have 1 review(s) for Theguardian.com

Add your review
Verified United Kingdom

 (11 months ago)
 

"Reputable news"


The Guardian is a reputable news provider, operating within the United Kingdom.

Theguardian.com Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Theguardian.com

H1 Headings

4 :
  1. News, sport and opinion from the Guardian's UK edition
  2. Progressive journalism, powered by subscribers
  3. Guardian Labs
  4. No ball games

H2 Headings

31 :
  1. Palette styles new do not delete
  2. Headlines
  3. Coronavirus
  4. Coronavirus data
  5. Coronavirus UK
  6. US elections 2020
  7. Spotlight
  8. Today in Focus
  9. Podcast Election 2020: Trump and the rise of white supremacist extremism
  10. Listen to previous episodes
  11. Opinion
  12. Letters treat
  13. Sport
  14. Contact the Guardian
  15. From the UK
  16. Around the world
  17. Digital subscription
  18. Climate crisis
  19. Video
  20. black-history-timeline
  21. Culture
  22. culture-treat
  23. Secret words and music The hidden gems we've found on our local high streets
  24. From smoked moose meat to cloudberry doughnuts 10 of the best food markets in Sweden
  25. Single malt cocktails Five original twists on the classics for autumn
  26. Beans three ways A trio of recipes for your store cupboard staple
  27. Lifestyle
  28. No Ball Games
  29. Take part
  30. Explore
  31. In pictures

H3 Headings

116 :
  1. Coronavirus Health chief in England's worst-hit Covid area calls for immediate lockdown
  2. BBC Staff allowed to attend Pride if they don’t make political points
  3. France attack Police question man over reported contact with basilica suspect
  4. 'There is power in them' Mysterious stone figures to be moved in Gaelic winter ritual
  5. Labour Starmer says Corbyn could have predicted suspension for EHRC response
  6. Live US election 2020: more signs of record turnout as candidates make final push
  7. Benefits Asylum-seekers' 3p-a-week increase is an insult, say campaigners
  8. Housing market UK house prices jump but slowdown is likely, says Nationwide
  9. Technology Calls to online child sexual abuse watchdog up 45% in September
  10. Migrants UN urges UK to urgently restart resettlement of refugees
  11. Live Coronavirus live: Russian vaccine may be available to Moscow residents next month
  12. Live Coronavirus live: Russian vaccine may be available to Moscow residents next month
  13. 'The best of humanity' The businesses providing free meals in England
  14. 'The best of humanity' The businesses providing free meals in England
  15. 'A mess' Paris sees record traffic jams ahead of lockdown
  16. 'A mess' Paris sees record traffic jams ahead of lockdown
  17. Lessons from abroad Why Estonia excels at digital learning during Covid
  18. Lessons from abroad Why Estonia excels at digital learning during Covid
  19. Homelessness Covid restrictions push more under-25s than ever to sleep rough in London, charities say
  20. Rising Covid infections in England How worried should we be?
  21. Furlough ONS finds 2m people still on scheme
  22. Childcare One in six providers in England may close by Christmas
  23. Keen to stay out of the way Why the US military would welcome a decisive 2020 election win
  24. 'Voters are fed up' Will Arizona's suburbs abandon the party of Trump?
  25. 'I look like him – but my hair’s real' Brazil's Trump takes to Amazon campaign trail but is backing Biden
  26. 'He's a salesman' Why rallies are Trump's last best hope of clinging to presidency
  27. The fear within 10 of the best scary films that aren’t horror movies
  28. Caleb Femi Henceforth I’m solely preoccupied with being a merchant of joy
  29. Experience I found a cry for help hidden in my Halloween decorations
  30. 'When I travelled, I hid my passport' Fassbinder muse Barbara Sukowa on Hitler's legacy and hidden love
  31. Grace Dent on restaurants Noble Rot Soho, London W1: 'Heavenly'
  32. Money Payment holidays are ending in the UK – but there are options
  33. 'Here we reconnect with humanity' Urban open spaces to lift the spirits
  34. ‘Long johns with a bum hatch’ Readers' secrets for staying warm outside this winter
  35. Tory chatter suggests the party's north-south divide extends far beyond Covid
  36. The world is rocked by protest – but does taking to the streets ever work?
  37. Despair or denial – are these the only options in the run-up to election night?
  38. In 1953, Britain openly removed an elected government, with tragic consequences
  39. Sunak needs to offer tools to help enterprises flourish
  40. Antisemitism in the Labour party was real and it must never be allowed to return
  41. Live Premier League team news, European latest and more: weekend football countdown
  42. 'Being a mum doesn’t win matches' Tennis stars turn their focus back to sport
  43. Premier League Ten things to look out for this weekend
  44. Manchester City's Chloe Kelly We aim to win two FA Cups in one season
  45. The cult of Diego Maradona – in pictures
  46. 'Dealt with internally' Solskjær praises response to hammering by Spurs
  47. Rugby union Australia's Palmer praised after coming out as gay
  48. Sports quiz of the week Six Nations, subs scoring hat-tricks and a sell-out
  49. Croydon Council on verge of bankruptcy after risky investments
  50. Business NatWest warns of challenging times ahead despite return to profit
  51. BBC New 'no bias' rules prevent staff joining LGBT pride marches
  52. Nazanin Zaghari-Ratcliffe UK expresses 'grave concern' over fresh court proceedings
  53. Tracey Emin Artist praised for frank disclosure of bladder cancer
  54. Met police Brothers stopped and searched for fist bump: we'll sue
  55. Isle of Wight Seven men bailed following suspected hijack of oil tanker off Isle of Wight
  56. Brexit Talks making 'good progress', says Ursula von der Leyen
  57. West Midlands Double murder suspect may be connected with third death
  58. Pizza Express Company to axe 1,300 jobs in latest cuts
  59. Qatar Staff who searched Australian women at Doha airport committed 'illegal actions'
  60. Referendum New Zealand votes to legalise euthanasia, but cannabis move set to fail
  61. Global development Women Deliver racism investigation verdict described as a 'slap in the face'
  62. Environment Scrap gas pipeline in eastern Med due to climate cost, says report
  63. Mexicans for Trump? Amlo supporters have unlikely pick in US election
  64. ‘This season is off the charts’ Colorado fights the worst wildfires in its recent history
  65. ‘Profit over death’ Millions of American diabetics struggle to afford insulin
  66. US Americans have bought record 17m guns in year of unrest, analysis finds
  67. US protests Nearly 1,000 instances of police brutality recorded in US anti-racism protests
  68. Canada Judge blocks attorney general's attempt to dismiss Meng Wanzhou's arguments
  69. Weather 2020 likely to be among warmest years on record despite La Niña
  70. 'We don't have time to lose' Plans for coral ark to help save the world's reefs
  71. US Deluged by floods, America’s ‘oldest city' struggles to save landmarks from climate crisis
  72. East Siberia 'Sleeping giant' Arctic methane deposits starting to release, scientists find
  73. Anywhere but Washington God and the GOP: will conservative evangelicals stay loyal to Trump?
  74. Explainer Why Biden calls Trump a 'climate arsonist'
  75. Black enough? Why the first US cowboys were black
  76. Thailand On the ground with Penguin, the protest leader risking jail
  77. Coronavirus What has changed about what we know?
  78. Space tourism Why hasn't it taken off?
  79. Tana French I cannot see the point of DH Lawrence’s Women in Love
  80. 'Something to scream about' Bring Me the Horizon's pandemic political awakening
  81. Barbara Hepworth Artist's time in London marked with blue plaque
  82. This week's home entertainment From US election night to Long Hot Summers
  83. Emeli Sandé’s teenage obsessions I spent hours in the Yahoo karaoke chatroom
  84. Educating Rita review Sharp-edged take on 1980s nostalgia piece
  85. The joy of small things I have never met a pharmacist I didn't like. I don't know what I'd do without them
  86. 'Zero-impact' Ecotricity founder to grow diamonds 'made entirely from the sky'
  87. The simple fix Thomasina Miers' Halloween recipe for miso roast pumpkin salad
  88. Scooby shack Secrets and mystery on an off-grid cabin retreat in west Cornwall
  89. Fantasy house hunt Edwardian homes for sale
  90. Drink Red wines to warm up bonfire night
  91. Tell us What are your experiences of racism in UK schools?
  92. Fitness Share your best tips for exercising at home with us
  93. England How long does it take to receive Covid test results?
  94. Coronavirus in the UK What is it like asking people to comply with restrictions?
  95. ‘I feel free here’ How a miracle girls' school was built in India's 'golden city'
  96. ‘Un-managing the land’ Sheep make way for trees in Cumbria's uplands
  97. What's the upside of winter? The bright side to all those dark months
  98. Whistleblowers Jewish Labour councillors who led EHRC antisemitism process tell of mental toll
  99. 'What made him come there?' Lukashenko's surprise meeting with his critics
  100. 'Try again next time' My three visa rejections
  101. Japan Taboo-breaking tattoo fans
  102. Cowboys, cats and Cruella 20 years of celebrity halloween costumes
  103. Halloween Illuminated pumpkins
  104. Panda toys, laser beams and pagan rites Thursday's best photos
  105. Seasonal scenes Autumn at National Trust gardens
  106. 'Fearlessness and freedom' Winners from the Female in Focus awards
  107. Coronavirus strain from Spain accounts for most UK cases – study
  108. Live UK coronavirus live: pressure mounts on Boris Johnson for immediate national lockdown
  109. Covid: Dominic Raab refuses to deny possibility of tier 4 restrictions
  110. The face mask test: which are the best at limiting the spread of Covid?
  111. Starmer says Corbyn could have predicted suspension for EHRC response
  112. Health chief in England's worst-hit Covid area calls for immediate lockdown
  113. Live US election 2020: Trump and Biden both head to crucial swing states Minnesota and Wisconsin - live
  114. Keir Starmer had his response ready. Then came Corbyn's post
  115. Ecotricity founder to grow diamonds 'made entirely from the sky'
  116. Live Coronavirus live news: Russian vaccine may be available to Moscow residents next month

H4 Headings

36 :
  1. Live UK coronavirus: pressure mounts on Boris Johnson for immediate national lockdown
  2. Dominic Raab Minister refuses to deny possibility of tier 4 Covid restrictions
  3. Covid-19 Strain from Spain accounts for most UK cases – study
  4. Live UK coronavirus: pressure mounts on Boris Johnson for immediate national lockdown
  5. Dominic Raab Minister refuses to deny possibility of tier 4 Covid restrictions
  6. Covid-19 Strain from Spain accounts for most UK cases – study
  7. Nice World leaders condemn attack as terror alert level raised to maximum
  8. Brazil Nice knife attack victim named as Simone Barreto Silva
  9. Nice World leaders condemn attack as terror alert level raised to maximum
  10. Brazil Nice knife attack victim named as Simone Barreto Silva
  11. The face mask test Which are the best at limiting the spread of Covid?
  12. France Children aged six and over to wear masks in school
  13. Scotland Country braces for tighter Covid controls under five-level system
  14. The face mask test Which are the best at limiting the spread of Covid?
  15. France Children aged six and over to wear masks in school
  16. Scotland Country braces for tighter Covid controls under five-level system
  17. Hidden horrors Our writers on the scariest movies you (probably) haven't seen
  18. Hidden horrors Our writers on the scariest movies you (probably) haven't seen
  19. Football Weekly Extra Saint Marcus and the 'real Solskjær?
  20. Burnley UK-Egyptian consortium target takeover
  21. Newcastle Club finally start refunding supporters
  22. Football Weekly Extra Saint Marcus and the 'real Solskjær?
  23. Burnley UK-Egyptian consortium target takeover
  24. Newcastle Club finally start refunding supporters
  25. The Recap Sign up for the best of the Guardian's sport coverage
  26. The Recap Sign up for the best of the Guardian's sport coverage
  27. 'Dear Boris' Delia Smith writes to PM urging him to let fans back
  28. 'Dear Boris' Delia Smith writes to PM urging him to let fans back
  29. The Recap Sign up and get our email of editors' picks
  30. The Recap Sign up and get our email of editors' picks
  31. Social media News staff told not to 'virtue signal' in crackdown
  32. Social media News staff told not to 'virtue signal' in crackdown
  33. Kylie Moore-Gilbert Iran moves detained academic back to Tehran prison
  34. Kylie Moore-Gilbert Iran moves detained academic back to Tehran prison
  35. Life and style Tell us about your best kitchen tips
  36. Life and style Tell us about your best kitchen tips

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

96 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-78705427-1

Links - Internal

378:

Links - Internal (nofollow)

0:

Links - Outbound

12:

Links - Outbound (nofollow)

4:

Keyword Cloud for Theguardian.com

3fccontainerheadertitlegallerytebindnullrreturnget2mealsformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttffcitemtitlebackgroundimagenonefccontainerstorypackagespread of covidholidaysfullguardian egyptiandevelopmenttif4eobjecttypeofall and minwidth6125emfctrailcountfctrailcountcommentcountsectionfccontainerinvestigationpalettedostrugglefcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks4autumnfcitemmediametawebguardianhealthrecap signfcsublinkfccontainerstorypackageminwidth6125emgvcoronaoverviewnecalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeoftakeheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwofffcitemhasfloatingsublinksfcitemisdynamiccardworldweeklyformattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian headlineoptionsminwidth 4625emfccontainerstorypackagefcitemcontainerfcitemmetabackgroundimagerepeatinglineargradienttowhy estoniaelection nightmuststarmer saysformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttf formattruetypefontweight600fontstyleitalicfontfacefontfamilyguardian headlinefcitemclassfcitempillarfcitemtypecommentfcitem fcsublinknationalweeklychangegvcoronaoverviewpartonlyformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoffsans webhelveticaboris140pxformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwofffcitemfcitemisdynamiccardfcitemlivefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttfplaydespitefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttfheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2coronavirusrelativescience techcallsleftglobalcould have predictedformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttf formattruetypefontweight600fontstyleitalicfontfacefontfamilyguardianhomefounderufauxblocklinkhoverminwidth6125emgsubsthrasherpatronsface maskeditionformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttfsupremacist extremismimggsubsthrasherdueupteeesmodulefunctionreturn edefaultfunctionreturn ereturnformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoffformattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2estoniafcitemisdynamiccardfcitemisboostedfcitemfcitemisdynamiccard fcitemtitlequotedlikelyminwidth30emgvcoronaoverviewtforvarspaniosbarbaraworsthit covid arealearningformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttflive coronavirus liveformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttffcitemfcitemisdynamiccard fctrailcountcommentcount inlineiconournewracismfcitemisdynamiccardfcitemthreequarterstabletfcitemhassublinks2 fcitemfooterhorizontalinvestigationtestlimitingheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoffpositionfcsublinktitleheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2limiting the spreadparisbidenformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttf formattruetypefontweight400fontstylenormalfontfacefontfamilyguardian headlinefcitemliveblogblocktextafterboxshadow3125remformattruetypefontweight700fontstyleitalicfontfacefontfamilyguardiantier 4live russian vaccinemost ukfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2seasonsociety science techantisemitismmedia allheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2lifeformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoffheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoffskyhearuk casesdigital learningfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2reexportsvar treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeofformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf formattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian headlineposition relative2020 trumpsees recordlive uk coronavirusformattruetypefontweight600fontstyleitalicfontfacefontfamilyguardiantest whichfemalecovidstarmer says corbynheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2nowebhelveticailluminatedarentformattruetypefontweight500fontstyleitalicfontfacefontfamilyguardianuk politicsmost uk casesformattruetypefontweight400fontstyleitalicfontfacefontfamilyguardianformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttflettersnugget lettersbuttonpeoplefrancefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwofffcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypelive fcsublinkformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardianfcitemshowrisk10pxformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoffwightsearchclimatesubscribepodcasts5pxheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwofftech global0625remtransparentformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttf formattruetypefontweight300fontstylenormalfontfacefontfamilyguardian headlinefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoffenglands worsthitnecalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeofbeenformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttfraabformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttf formattruetypefontweight500fontstylenormalfontfacefontfamilyguardian3125rem 125remnicehave predicted suspensionfcitemfooterhorizontalmask testsocial mediaface mask testpremier league0mediafullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoffwebhelvetica neuehelveticaariallucidaclubheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2tvarexperiencewhy estonia excelsobjectprototypehasownpropertycalletopoos2functionetneexportsn3functionetvarlpanel imggsubsthrasher flexformattruetypefontweight500fontstylenormalfontfacefontfamilyguardian headlinesupportfcsublinkglobal developmentculturefcitem ufauxblocklinkhoverfcitemisdynamiccardfcitemfullmedia100tableteducation society sciencefcitemfcitemisdynamiccard ufauxblocklinkhoversecretsfcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttffcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks4 fcitemfooterhorizontalflex lpaneltitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2rugbyufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125remreturnallowedresponseformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttfhouseformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffus electionmountsegyptian webguardianswitchheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2nonfunctionevar teeesmodulefunctionreturn edefaultfunctionreturnvaccinearchivefontfacefontfamilyguardian headlineformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2whymarginbottomschoolfcitemisdynamiccardfcitemthreequarterstabletfcitemhassublinks2fcitem fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradienttostreetsworldsrulesdisplayjohnson for immediatehave beenexcels at digitalfcitemstandfirstwrapper fcitemmetabackgroundimagenonefccontainerstorypackagesociety sciencethereformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttf formattruetypefontweight500fontstylenormalfontfacefontfamilyguardian headlinelettersnugget h1hotjohnsonfcitemcontentabovepadding0375rem 0mediafcitemliveblogblocktextafterboxshadow3125rem 012pxformatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardian4624emfccontainerstorypackagecovid areaafterheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwofffcitemhasfloatingsublinksfcitemisdynamiccard fcsublinkfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2neverbusinesses providing freebottom808a9b808a9b 0625remtransparentwhite supremacist extremismlifestyleformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttfchiefstatestitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttftttesmodulereturn tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeofheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2hasprotestssectionletterstreatlettersnugget culturenuggetimagecoronavirus football environmenteyes eyelive coronaviruscontactfootball environment ukprotestfcitemliveupdatesmargintopfreshformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttf formattruetypefontweight400fontstylenormalfontfacefontfamilyguardianimggsubsthrasher flex rpanelspainfcitemliveupdates ufauxblocklinkhoverfcitemcontentabovepadding0375rem 0media maxwidthfansformattruetypefontweight900fontstylenormalfontfacefontfamilyguardianimmediatedenyfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2monthsupportersformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttf formattruetypefontweight300fontstylenormalfontfacefontfamilyguardianfontsizeformattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2solskjrtreiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturnautomediaformattruetypefontweight500fontstylenormalfontfacefontfamilyguardianformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttf formattruetypefontweight700fontstyleitalicfontfacefontfamilyguardianmay be availableget ourlastwhite supremacistbutyouheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttf formattruetypefontweight600fontstylenormalfontfacefontfamilyguardian headlinemargin 0educationtforvar rsocialmilitaryoutfcitemfcitemtypecommentfcitemhascutoutyearsformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoffmarcusapptheirformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttf formattruetypefontweight300fontstyleitalicfontfacefontfamilyguardianworsthit covidspreadheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoffdoesehrc response5formattruetypefontweight900fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2availablefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff2russianfcitemliveblogblocktextafterboxshadow3125rem 0 3125remformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttf formattruetypefontweight600fontstylenormalfontfacefontfamilyguardianimggsubsthrasher flexformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoffsixwhiteh1formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoffsuspension for ehrcfcsublink fcsublinklinksectionfccontainereventaltpalettetoldformattruetypefontweight500fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2fcitemfooterhorizontal fcsublinkfccontainerstorypackagepoliticsemailmask test whichhorroraheadformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttf formattruetypefontweight900fontstyleitalicfontfacefontfamilyguardianacrossfcitemtitlequotedheadlineanimationspain accountsteeesmodulefunctionreturnstaffformattruetypefontweight300fontstyleitalicfontfacefontfamilyguardian headlineheadlineguardian egyptianfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttfstarmerformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttf formattruetypefontweight400fontstyleitalicfontfacefontfamilyguardian headlinefcitemiscommentablenotfcitemtypecomment fcitemmetaminwidthcalc4chrfcitemfcitemtypecommentnotfcitempillarspecialreportfcitem fctrailcountcommentcountformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttf formattruetypefontweight900fontstyleitalicfontfacefontfamilyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2live us electionenvironment ukdeny possibilityreadersr in todnrfunctionereturnknowwarmminwidthdisplay blockfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwofffcitem fcitemmediametaheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwofffullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2policerfunction oeifrereturn reexportsvararound the worldformattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoffpraisedsignelection 2020waysayestonia excelswestdecisivecases1fcitemfcitemisdynamiccard fcitemliveblogblocktextafterboxshadow3125rem 0weekendmybrothersereturn odtattoofunctionetreturnsansuk coronavirusfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf3125remidocumentqueryselectorhtmlldocumentqueryselectorbodylclasslistaddgeliveblogistyleoverflowhiddenistylepadding0istylemargin0lstyleoverflowhiddenlstylepadding0lstylemargin0settimeoutfunctionwindowresize100fcitem youtubemediaatomplaybutton inlineplaymost viewed mostfcitemfooterhorizontalfccontainerstorypackageimmediate nationaljoyisle of wightmostformattruetypefontweight700fontstyleitalicfontfacefontfamilyguardian headlinefcitemstandfirstwrapperformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf formattruetypefontweight500fontstyleitalicfontfacefontfamilyguardiancoronavirus livefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoffeditorsfcitemmetabackgroundimagenonefccontainerstorypackage0625remtransparent 0625remtransparentlearning during covidpredictedmaxwidthoverflow hiddenformattruetypefontweight300fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2resultsstrain from spainshare yourhave predictedufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125rem 0englandstif4eobjecttypeof tttesmodulereturnmost viewednational lockdownlettersbuttonbottom808a9b808a9bexcelsteamrefuses to denytebindnullrreturn nonfunctionevar teeesmodulefunctionreturnformattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headlineelectionminwidth6125em lettersnuggetrightfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwofflast weeklettersnugget culturenuggetarrowrecapproviding freeecotricitypumpkinsbusinessfree mealsenglands worsthit covidthreelive ukhistorysporttreiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeofviewed mostviewed most viewedtodnrfunctionereturn tebindnullrreturn nonfunctionevareuropeanfcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9b 0625remtransparentheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoffmaxwidth 4624emfccontainerstorypackagegooglefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2search jobsbottom808a9b808a9b 0625remtransparent 0625remtransparenthisduring covidhours4625emfccontainerstorypackagemayguardiansformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttfformattruetypefontweight600fontstylenormalfontfacefontfamilyguardiantebindnullrreturn nonfunctionevarsaveuk editionelementinteractivecontentmaincolumninteractivenbspv lasteyemakingfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwofflettersnuggetformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardianamericanaccounts for mostformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttf formattruetypefontweight700fontstyleitalicfontfacefontfamilyguardian headlineegyptianformattruetypefontweight600fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttf formattruetypefontweight500fontstyleitalicfontfacefontfamilyguardianformattruetypefontweight400fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2herefcitemfcitemisdynamiccardfcitemliveupdatesareachief in englandsimmediate national lockdownschoolsfcitemliveupdatesfcitemthreequarterstalltablettttesmodulereturnrfunctionbackformattruetypefontweight300fontstyleitalicfontfacefontfamilyguardianoeifrereturn reexportsvar treiel1exportsreturndeathnightdiamondsfctrailcountfctrailcountcommentcountsectionfccontainerlongrunningpaletteminwidth8125emtrafficboris johnsonsans webhelvetica neuehelveticaariallucidawidthmeals in englandheadline fullguardian egyptianformattruetypefontweight900fontstyleitalicfontfacefontfamilyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwofffcitemhasfloatingsublinksfcitemisdynamiccardclassfcitemhassublinksformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoffdigital learning duringtvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvarformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headlinewantnoneformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttfblackhistorytimelinefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2itstipsheadline fullguardiansays corbyn couldpolitics educationarea callsfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttfprovidingsymbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeofminwidth 6125emfccontainerstorypackageoverflowcovid area callsformattruetypefontweight700fontstylenormalfontfacefontfamilyguardianrefusesformattruetypefontweight300fontstylenormalfontfacefontfamilyguardian headlinefcsublinkkickerdisplayblockwidth100fccontainerstorypackagefootball weeklywaysallduringsign upfcitemfcitemisdynamiccardfcitempillarnewsgovernmentfcitempillarnewsthosecoveragefcitemisdynamiccardextremismfiguresfcitemmediameta inlineiconsheepformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoffgardensrfunction oeifrereturnfcitemisdynamiccardfcitemthreequarterstalltabletformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwofffullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoffwidth 140pxvideofootball environmentpreventstarslondongrow diamondsvjsbigplaybuttonformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicttfformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttfaccountsrpanelrecordcorbyntraffic jamsseesoverformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttfdonttext sans webhelveticapartyfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinksheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2sciencemoscow residents nexttreatscontainermakelatestfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2humanitymoreplay videoherlockdownfindminwidth7125embodynothasactivepageskinformattruetypefontweight600fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2fcitem fcitemmediameta inlineiconlpanel imggsubsthrasherpolitics education societymaskpressure mountsgrow diamonds madefcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypelivecouldfunctionnvar rfunctiontheyfcsublinklinksectionfccontainereventpaletteformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttf formattruetypefontweight900fontstylenormalfontfacefontfamilyguardianwinterthingsenglandedefaultfunctionreturn ereturncomingheight6pxfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinks ufauxblocklinkhoverflexfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2immediate lockdownyourrestrictionsfunctionnvar rfunction oeifrereturnnbspv last weekfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttfedefaultfunctionreturn ereturn odtattoofunctionetreturnculturenuggetimage4newscoronavirus footballjobsodtattoofunctionetreturn objectprototypehasownpropertycalletopoos2functionetneexportsn3functionetvarcornwallfcitemtypecommentletterssuspensionpossibility of tiercovid19formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoffnext monthformattruetypefontweight700fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2nextcould haveereturn odtattoofunctionetreturn objectprototypehasownpropertycalletopoos2functionetneexportsn3functionetvarmetrules preventtwofcsublinksfccontainerstorypackage10pxmediaoeifrereturn reexportsvarculturenuggetarrowminwidth6125emukformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttf formattruetypefontweight700fontstyleitalicfontfacefontfamilyguardianlive usfaceformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttfheadnational truststraintellfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwofffcitem vjsbigplaybuttoncity0media maxwidthtodnrfunctionereturn tebindnullrreturnviewedflex rpanelweformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardianfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2trumpformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttf formattruetypefontweight400fontstyleitalicfontfacefontfamilyguardiannonfunctionevaroffformattruetypefontweight500fontstyleitalicfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttftraffic jams aheadfcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9bfcitemisdynamiccardfcitemhasfloatingsublinksbusinessestrustformattruetypefontweight900fontstyleitalicfontfacefontfamilyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2helpfcitemfcitemisdynamiccard fctrailcountcommentcountformattruetypefontweight400fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2writersformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttfcalls for immediatebestoeifrereturnformattruetypefontweight300fontstylenormalfontfacefontfamilyguardianformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoffmade entirelysuspectinlineiconminwidth6125emgsubsthrasher flexsupremacistfcitem youtubemediaatomplaybuttonelection 2020 trump0 3125rem 125remmoscow residentsdevelopment obituarieslearning duringheadlineinlineplayformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackitalicttf formattruetypefontweight900fontstyleitalicfontfacefontfamilyguardianheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff1sfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttfformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttftitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff14pxlettersnugget culturenuggetbuttonsrdocumentqueryselectorhtmlodocumentqueryselectorbodyrstyleoverflowhiddenrstylemargin0pxrstylepadding0pxostyleoverflowhiddenostylemargin0pxostylepadding0pxifwindowframeelementwindowframeelementclasslistcontainsinteractiveatomfencevar idocumentqueryselectorhtmlldocumentqueryselectorbodylclasslistaddgeliveblogistyleoverflowhiddenistylepadding0istylemargin0lstyleoverflowhiddenlstylepadding0lstylemargin0settimeoutfunctionwindowresize100everlabourrecord traffic jamsformattruetypefontweight900fontstylenormalfontfacefontfamilyguardian headlinelikeentirely0best at limitingfollowingfounder to growmenformattruetypefontweight400fontstyleitalicfontfacefontfamilyguardian headlineopinionmonthsminwidth375emgvcoronaoverviewheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2environmentfootballeducation society3sflex lpanel imggsubsthrasherlabsworknowfcsublink fcsublinklinksectionfccontainereventpalettelockdown dominicfinaltext sansformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttf formattruetypefontweight600fontstylenormalfontfacefontfamilyguardianformattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttffcitemfcitemisdynamiccardtechminwidth8125embodynothasactivepageskinfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttffoundmediaexperiencesformattruetypefontweight600fontstylenormalfontfacefontfamilyguardian headlinerecipes125rembackgroundcolorfcsublinklinksectionfccontainereventaltpalettelettersnugget maxwidthtodnrfunctionereturnhealth chiefstoriessearchedheadlineguardiansolidstayguardianpridemoviespaidtiermounts on borisnobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar rlive russianwinrdocumentqueryselectorhtmlodocumentqueryselectorbodyrstyleoverflowhiddenrstylemargin0pxrstylepadding0pxostyleoverflowhiddenostylemargin0pxostylepadding0pxifwindowframeelementwindowframeelementclasslistcontainsinteractiveatomfencevarnbspvlooktext egyptianpictureseyesedition switchresidents nextloveyoutubemediaatomplaybutton inlineplayfcitemisdynamiccardfcitemfullmedia75tabletfcitemhassublinks3 fcitemfooterhorizontalgamesthemoctoberpressuredominicusamazonfctrailcountcommentcount inlineiconyour bestpremierfontfacefontfamilyguardianfctrailcountfctrailcountcommentcountsectionfccontainerbreakingpalettetech global developmentwarnsstayingscience tech globalculturenuggetbuttonsrussian vaccine mayampstudyformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttf formattruetypefontweight300fontstyleitalicfontfacefontfamilyguardianbusiness coronavirus footballrecord trafficwouldyoutubemediaatomplaybuttonfreeliveformattruetypefontweight300fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff2paris seessays corbynfcitem fcsublinktitlefcitemfcitemisdynamiccardfcitemtypecommentnotfcitempillarspecialreportattacksymbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturnhavefcitemfcitemisdynamiccard ufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125remjamspaddingtopminwidth8125em lettersnuggetfccontainerinnerbordertop1pxfcitemfcitemliveformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldwoff2halloweengasbusinesses providingcampaignteeesmodulefunctionreturn edefaultfunctionreturnformattruetypefontweight900fontstyleitalicfontfacefontfamilyguardianpoliticalfctodayfcitemtypelive fcsublinknecalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturnformattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2treturnodtattoofunctionetreturnformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttfehrcpredicted suspensionfcitemfcitemisdynamiccardfcitemliveupdates ufauxblocklinkhoverformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttf formattruetypefontweight900fontstylenormalfontfacefontfamilyguardian headlinefcitemiscommentablenotfcitemtypecommentuk cases studyheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2madeformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttfrecap sign upprofitnonfunctionevar teeesmodulefunctionreturnfullguardiansharevaccine mayheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoffformattruetypefontweight400fontstylenormalfontfacefontfamilyguardiannobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeofformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineboldttfformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttf formattruetypefontweight600fontstyleitalicfontfacefontfamilyguardiansees record trafficformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttfweeksdiamonds made entirelyformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttffcitem fctrailcountcommentcount inlineiconcannabis0 3125remfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwofftimeelementatomcontentmaincolumninteractivejapanpgrowingmarginleftlpaneltennisparis sees recorddigitalcountrymarginavailable to moscowexperiences of racismweekfcitemfcitemisdynamiccardclassfcitempillarfcitemtypecomment2pxrealclimate crisisereturncorbyn couldobituarieshimneuehelveticaariallucidaformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttffocusfunctionnvarfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumitalicwoff2treiel1exportsreturnblockformattruetypefontweight600fontstyleitalicfontfacefontfamilyguardian headlinefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2growformatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepieceboldttf formattruetypefontweight700fontstylenormalfontfacefontfamilyguardian headlineecotricity foundereventsformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttf formattruetypefontweight500fontstylenormalfontfacefontfamilyguardiantexttopdiamonds madefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoffcorbyn could havetvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeoftalksbluelineheightguardian labsreexportsvarformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularttf formattruetypefontweight400fontstylenormalfontfacefontfamilyguardianformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightttf formattruetypefontweight300fontstylenormalfontfacefontfamilyguardianoutsidesymbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof tttesmodulereturnsocietysvgmoscowfcitemliveupdatesfcitemfullmedia100tabletreexportsvar treiel1exportsreturnaroundwhichuk politics educationfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemibolditalicttffcitemmetaminwidthcalc4chdominic raabformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightitalicttf formattruetypefontweight300fontstyleitalicfontfacefontfamilyguardian headline0media maxwidth 4624emfccontainerstorypackagecontentfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinks fcsublinktttesmodulereturn tvarchildrensaystif4eobjecttypeof tttesmodulereturn tvarjams aheadfctrailcountcommentcounttell ushiddenleagueproviding free mealsbusiness coronavirusfcitemfcitemisdynamiccard fcitemliveblogblocktextafterboxshadow3125remformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackttf formattruetypefontweight900fontstylenormalfontfacefontfamilyguardianprintfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularwoffcases studyfcitemcontentbelowpadding0fccontainerstorypackageledformattruetypefontweight400fontstylenormalfontfacefontfamilyguardian headlinerussian vaccinelongbeing6125emfccontainerstorypackageedefaultfunctionreturnheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineblackwoffthesefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinesemiboldttffcitemcontentabovepadding0375remisleglobal development obituariesformatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttfsecuredropiosall and minwidth8125emfcitemtypelivefccontainerinnerbordertop1px solidpossibilityahead of lockdownnotworsthitfctrailcountfctrailcountcommentcountsectionfccontainersombrepaletteformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttf formattruetypefontweight400fontstyleitalicfontfacefontfamilyguardianfcitemliveformatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlineregularitalicttfheadline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinelightwoffus election 2020illuminated pumpkinsexploreresidents next monthresidentsenvironment uk politicsfullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinebolditalicttfcrisisfcitem fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9bwomencoronavirus live russianelementatomcontentmaincolumninteractive elementinteractivecontentmaincolumninteractivefullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadlinemediumttfnobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvarblack

Longtail Keyword Density for Theguardian.com

KeywordsOccurences
0 3125rem -125rem26
fc-itemliveblog-blocktextafterbox-shadow-3125rem 0 3125rem26
u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem 013
fc-item fc-itemmedia-meta inline-icon12
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff10
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf10
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff8
sans webhelvetica neuehelveticaariallucida8
text sans webhelvetica8
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf8
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian headline7
formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff27
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff7
formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian7
formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff27
formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff7
formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff27
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff7
formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff7
titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf7
formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff7
formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff7
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff7
formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian headline7
formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff27
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian headline7
formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff27
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian headline7
headline fullguardian egyptian6
fc-item fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b6
fc-itemcontent--abovepadding0375rem 0media max-width6
0media max-width 4624emfc-container--story-package6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b 0625remtransparent6
bottom808a9b808a9b 0625remtransparent 0625remtransparent6
fc-itemfc-item--is-dynamic-card fc-itemliveblog-blocktextafterbox-shadow-3125rem 06
fc-itemfc-item--is-dynamic-card u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem6
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline5
font-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff25
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian5
moscow residents next5
residents next month5
russian vaccine may5
may be available5
available to moscow5
limiting the spread4
tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar4
nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar r4
r in todnrfunctionereturn4
todnrfunctionereturn tebindnullrreturn nonfunctionevar4
tif4eobjecttypeof tttesmodulereturn tvar4
tebindnullrreturn nonfunctionevar teeesmodulefunctionreturn4
nonfunctionevar teeesmodulefunctionreturn edefaultfunctionreturn4
teeesmodulefunctionreturn edefaultfunctionreturn ereturn4
edefaultfunctionreturn ereturn odtattoofunctionetreturn4
ereturn odtattoofunctionetreturn objectprototypehasownpropertycalletopoos2functionetneexportsn3functionetvar4
chief in englands4
englands worst-hit covid4
tttesmodulereturn tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof4
treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn4
symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof tttesmodulereturn4
necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof4
covid area calls4
reexportsvar treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof4
oeifrereturn reexportsvar treiel1exportsreturn4
rfunction oeifrereturn reexportsvar4
functionnvar rfunction oeifrereturn4
fc-itemfc-item--is-dynamic-card fc-trailcount--commentcount inline-icon4
flex l-panel imgg-subs-thrasher4
l-panel imgg-subs-thrasher flex4
imgg-subs-thrasher flex r-panel4
founder to grow4
grow diamonds made4
diamonds made entirely4
worst-hit covid area4
calls for immediate4
spread of covid4
have predicted suspension4
all and min-width8125em4
election 2020 trump4
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff24
best at limiting4
mask test which4
face mask test4
recap sign up4
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff24
us election 20204
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf4
suspension for ehrc4
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff4
could have predicted4
johnson for immediate4
says corbyn could4
starmer says corbyn4
uk cases study4
most uk cases4
accounts for most4
strain from spain4
possibility of tier4
corbyn could have4
refuses to deny4
immediate national lockdown4
mounts on boris4
most viewed most3
experiences of racism3
isle of wight3
white supremacist extremism3
nbspv last week3
around the world3
all and min-width6125em3
business coronavirus football3
why estonia excels3
learning during covid3
live us election3
football environment uk3
environment uk politics3
uk politics education3
politics education society3
education society science3
society science tech3
science tech global3
tech global development3
global development obituaries3
fc-item fc-trailcount--commentcount inline-icon3
fc-item youtube-media-atomplay-button inline-play3
live uk coronavirus3
live coronavirus live3
digital learning during3
coronavirus live russian3
live russian vaccine3
businesses providing free3
providing free meals3
meals in england3
paris sees record3
sees record traffic3
record traffic jams3
traffic jams ahead3
ahead of lockdown3
coronavirus football environment3
excels at digital3
viewed most viewed3
fc-itemliveblog-blocktextafterbox-shadow-3125rem 026
0 3125rem26
3125rem -125rem26
fc-itemfc-item--is-dynamic-card u-faux-block-link--hover24
fc-item u-faux-block-link--hover18
fc-item fc-itemmedia-meta18
u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem13
fc-itemmedia-meta inline-icon12
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian headline12
fc-containerinnerborder-top1px solid12
media all11
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf11
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff210
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff10
fc-item--has-floating-sublinksfc-item--is-dynamic-card fc-sublink10
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf10
min-width 4625emfc-container--story-package9
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks fc-sublink8
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf8
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff8
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff28
fc-itemfc-item--is-dynamic-card fc-trailcount--commentcount8
coronavirus live8
text sans8
sans webhelvetica8
webhelvetica neuehelveticaariallucida8
max-width 4624emfc-container--story-package8
us election8
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf7
formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff7
formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff27
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf7
formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff27
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian7
formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian headline7
formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian headline7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf7
formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian headline7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian headline7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian7
titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf7
formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff27
headline fullguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff7
0625remtransparent 0625remtransparent7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff27
fc-trailcount--commentcount inline-icon7
formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff27
formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian headline7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff7
headline fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf7
fc-item fc-trailcount--commentcount6
fc-item fc-sublink6
sign up6
fc-itemcontent--abovepadding0375rem 0media6
fullguardian egyptian6
headlineguardian egyptian6
fc-itemstandfirst-wrapper fc-itemmetabackground-imagenonefc-container--story-package6
play video6
0media max-width6
edition switch6
election 20206
bottom808a9b808a9b 0625remtransparent6
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks u-faux-block-link--hover6
fc-item fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b6
fc-item--type-live fc-sublink6
fc-item--is-commentablenotfc-item--type-comment fc-itemmetamin-widthcalc4ch6
fc-item vjs-big-play-button6
fc-item--live-updates u-faux-block-link--hover6
fc-item fc-sublinktitle6
fc-itemfc-item--is-dynamic-card fc-itemliveblog-blocktextafterbox-shadow-3125rem6
fc-itemfc-item--is-dynamic-cardfc-item--live-updates u-faux-block-link--hover6
boris johnson5
residents next5
moscow residents5
vaccine may5
russian vaccine5
climate crisis5
font-facefont-familyguardian headline5
functionnvar rfunction5
uk cases5
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian5
guardian labs5
next month5
letters-nugget max-width4
search jobs4
egyptian webguardian4
text egyptian4
margin 04
2020 trump4
letters-nugget culture-nuggetimage4
eyes eye4
uk edition4
edefaultfunctionreturn ereturn4
nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof tforvar4
tforvar r4
todnrfunctionereturn tebindnullrreturn4
tebindnullrreturn nonfunctionevar4
nonfunctionevar teeesmodulefunctionreturn4
teeesmodulefunctionreturn edefaultfunctionreturn4
ereturn odtattoofunctionetreturn4
tttesmodulereturn tvar4
odtattoofunctionetreturn objectprototypehasownpropertycalletopoos2functionetneexportsn3functionetvar4
health chief4
englands worst-hit4
worst-hit covid4
covid area4
immediate lockdown4
imgg-subs-thrasher flex4
tvar nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof4
tif4eobjecttypeof tttesmodulereturn4
uk coronavirus4
global development4
most viewed4
your best4
made entirely4
diamonds made4
grow diamonds4
ecotricity founder4
flex r-panel4
symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn tif4eobjecttypeof4
fc-itemfc-item--is-dynamic-card fc-itemtitle--quoted4
fc-item--has-floating-sublinksfc-item--is-dynamic-cardfc-item--type-live fc-sublink4
rfunction oeifrereturn4
oeifrereturn reexportsvar4
reexportsvar treiel1exportsreturn4
treiel1exportsreturn necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof4
necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn4
l-panel imgg-subs-thrasher4
area calls4
pressure mounts4
have predicted4
premier league4
recap sign4
test which4
mask test4
face mask4
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff24
immediate national4
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff2 formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff4
letters-nugget letters-button4
min-width 6125emfc-container--story-package4
ehrc response4
predicted suspension4
fc-itemfooter--horizontal fc-sublinkfc-container--story-package4
could have4
spain accounts4
national lockdown4
corbyn could4
dominic raab4
deny possibility4
tier 44
election night4
most uk4
flex l-panel4
starmer says4
says corbyn4
cases study4
share your3
letters-nugget h13
overflow hidden3
letters-nugget culture-nuggetbuttons3
national trust3
position relative3
illuminated pumpkins3
football weekly3
min-width8125em letters-nugget3
tell us3
display block3
min-width6125em letters-nugget3
width 140px3
social media3
letters-nugget culture-nuggetarrow3
min-width6125emg-subs-thrasher flex3
get our3
rdocumentqueryselectorhtmlodocumentqueryselectorbodyrstyleoverflowhiddenrstylemargin0pxrstylepadding0pxostyleoverflowhiddenostylemargin0pxostylepadding0pxifwindowframeelementwindowframeelementclasslistcontainsinteractive-atom-fencevar idocumentqueryselectorhtmlldocumentqueryselectorbodylclasslistaddge-liveblogistyleoverflowhiddenistylepadding0istylemargin0lstyleoverflowhiddenlstylepadding0lstylemargin0settimeoutfunctionwindowresize1003
sees record3
supremacist extremism3
tech global3
rules prevent3
live uk3
lockdown dominic3
fc-sublink fc-sublinklinksectionfc-container--event-alt-palette3
fc-sublink fc-sublinklinksectionfc-container--event-palette3
youtube-media-atomplay-button inline-play3
fc-item youtube-media-atomplay-button3
development obituaries3
science tech3
live us3
society science3
education society3
politics education3
uk politics3
environment uk3
football environment3
coronavirus football3
business coronavirus3
have been3
fc-item--is-dynamic-cardfc-item--three-quarters-tabletfc-item--has-sublinks-2 fc-itemfooter--horizontal3
white supremacist3
jams ahead3
last week3
nbspv last3
element-atomcontentmain-column--interactive element-interactivecontentmain-column--interactive3
during covid3
learning during3
digital learning3
estonia excels3
why estonia3
traffic jams3
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-3 fc-itemfooter--horizontal3
record traffic3
paris sees3
free meals3
providing free3
businesses providing3
live russian3
live coronavirus3
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-4 fc-itemfooter--horizontal3
viewed most3
fc-item119
fc-itemfc-item--is-dynamic-card116
headline99
u-faux-block-link--hover75
all38
036
fc-sublink34
uk34
us31
letters-nugget30
solid30
guardian27
3125rem26
fc-itemliveblog-blocktextafterbox-shadow-3125rem26
fc-item--live-updates26
-125rem26
fc-itemfc-item--is-dynamic-cardfc-item--live-updates24
covid23
best23
egyptian23
fc-item--has-floating-sublinksfc-item--is-dynamic-card22
coronavirus21
live20
inline-icon19
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks18
fc-itemmedia-meta18
more18
but18
have18
fc-itemfc-item--live18
headline-animation16
fc-itemtitle--quoted16
new16
min-width16
says16
media15
flex15
election15
fc-trailcount--commentcount14
news14
0625remtransparent14
up14
fc-containerheadertitle13
width13
113
fc-itemmetabackground-imagenonefc-container--story-package12
lockdown12
fc-containerinnerborder-top1px12
text12
trump12
edition12
max-width12
fc-item--has-floating-sublinksfc-item--is-dynamic-cardclassfc-item--has-sublinks12
world12
fc-itemfc-item--is-dynamic-cardfc-item--live12
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardian12
football12
most11
eyes11
formatwoffurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldttf11
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff11
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightttf10
hidden10
our10
fc-item--has-floating-sublinksfc-item--is-dynamic-cardfc-item--type-live10
sport10
why10
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff210
fc-item--is-dynamic-card10
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightwoff10
out10
record9
4625emfc-container--story-package9
his9
amp9
fc-itemfooter--horizontal9
back9
make9
over9
digital9
response8
gallery8
your8
immediate8
fc-sublinksfc-container--story-package8
calls8
fc-item--is-dynamic-cardfc-item--has-floating-sublinks8
available8
4624emfc-container--story-package8
cases8
neuehelveticaariallucida8
may8
webhelvetica8
staff8
sans8
jobs8
help8
we8
sign8
like8
climate8
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularttf8
video8
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff8
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularwoff28
formattruetypefont-weight600font-styleitalicfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumttf7
formattruetypefont-weight300font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff27
national7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicttf7
formattruetypefont-weight300font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicttf7
formattruetypefont-weight400font-styleitalicfont-facefont-familyguardian7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackitalicwoff7
halloween7
10pxmedia7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicttf7
formattruetypefont-weight900font-styleitalicfont-facefont-familyguardian7
27
formattruetypefont-weight400font-stylenormalfont-facefont-familyguardian7
titlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff27
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff27
formattruetypefont-weight500font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff27
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicttf7
formattruetypefont-weight600font-stylenormalfont-facefont-familyguardian7
crisis7
has7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-regularitalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-boldttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-bolditalicttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semibolditalicwoff27
formattruetypefont-weight700font-styleitalicfont-facefont-familyguardian7
formattruetypefont-weight900font-stylenormalfont-facefont-familyguardian7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff27
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackwoff7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldttf7
last7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff7
fullguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-blackttf7
fullsrcurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-semiboldwoff27
formattruetypefont-weight500font-styleitalicfont-facefont-familyguardian7
formatwoffurlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicttf7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-mediumitalicwoff7
formatwoff2urlhttpsinteractiveguimcoukfontsgarnettghguardianheadline-lightitalicwoff7
height7
boris7
paid7
fc-itemclassfc-item--pillar-fc-item--type-comment7
not7
women7
play7
min-width6125emg-subs-thrasher7
opinion7
switch7
my7
search7
subscribe7
fc-itemcontent--abovepadding0375rem6
face6
being6
off6
month6
next6
moscow6
fc-itemcontent--belowpadding0fc-container--story-package6
0media6
fc-itemfc-item--is-dynamic-cardfc-item--type-commentnotfc-item--pillar-special-report6
fc-sublinkkickerdisplayblockwidth100fc-container--story-package6
fc-itemstandfirst-wrapper6
fc-item--is-dynamic-cardfc-item--three-quarters-tall-tablet6
fc-item--live-updatesfc-item--three-quarters-tall-tablet6
fc-itemfc-item--is-dynamic-cardclassfc-item--pillar-fc-item--type-comment6
vjs-big-play-button6
london6
fc-item--is-dynamic-cardfc-item--three-quarters-tabletfc-item--has-sublinks-26
fc-itemfc-item--is-dynamic-cardfc-item--pillar-news6
fc-item--is-dynamic-cardfc-item--full-media-100-tablet6
test6
latest6
fc-itemmetamin-widthcalc4ch6
fc-today6
home6
tell6
take6
league6
time6
you6
guardians6
fc-item--type-comment6
fc-sublinktitle6
fc-item--is-commentablenotfc-item--type-comment6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto6
during6
bottom808a9b808a9b6
no6
fc-itemfc-item--type-commentnotfc-item--pillar-special-report6
two6
fc-item--live6
win6
fc-item--type-live6
fc-item--live-updatesfc-item--full-media-100-tablet6
content6
culture-nuggetimage6
winter6
starmer6
letters-button6
ehrc6
labour6
its6
headlineguardian6
email6
political6
restrictions6
attack6
long6
night6
margin-bottom6
font-size6
been6
after6
get5
ahead5
police5
10px5
england5
2px5
told5
school5
font-facefont-familyguardian5
vaccine5
dont5
labs5
readers5
dominic5
position5
culture5
lifestyle5
6px5
made5
diamonds5
background-color5
they5
health5
love5
podcasts5
pictures5
racism5
line-height5
which5
find5
him5
does5
functionnvar5
city5
rfunction5
real5
recap5
focus5
could5
movies5
ereturn5
fc-itemtitlebackground-imagenonefc-container--story-package5
russian5
residents5
found5
johnson5
stories5
stars5
government5
biden5
r5
there5
their5
grow4
praised4
margin-left4
min-width8125em4
save4
overflow4
sky4
entirely4
formattruetypefont-weight700font-stylenormalfont-facefont-familyguardiantitlepiecesrcurlhttpsinteractiveguimcoukfontsgarnettgtguardiantitlepiece-boldwoff24
tips4
history4
margin4
margin-top4
padding-top4
staying4
secrets4
fans4
autumn4
three4
options4
top4
ecotricity4
years4
founder4
none4
antisemitism4
r-panel4
display4
share4
svg4
never4
party4
protests4
return4
only4
would4
way4
now4
supporters4
week4
34
must4
min-width375emgv-corona-overview4
imgg-subs-thrasher4
searched4
l-panel4
talks4
gas4
weekend4
premier4
warm4
fresh4
work4
despite4
min-width7125embodynothas-active-pageskin4
these4
eye4
white4
weekly-changegv-corona-overview4
solskjr4
viewed4
webguardian4
possibility4
odtattoofunctionetreturn4
objectprototypehasownpropertycalletopoos2functionetneexportsn3functionetvar4
october4
englands4
worst-hit4
area4
pressure4
mounts4
raab4
refuses4
deny4
tier4
teeesmodulefunctionreturn4
covid-194
strain4
spain4
accounts4
study4
allowed4
pride4
contact4
suspect4
nice4
her4
corbyn4
edefaultfunctionreturn4
nonfunctionevar4
suspension4
fc-itemfc-item--type-commentfc-item--has-cutout4
support4
business4
environment4
politics4
society4
global4
development4
do4
holidays4
events4
weekly4
fc-sublinklinksectionfc-container--event-palette4
tebindnullrreturn4
fc-sublinklinksectionfc-container--event-alt-palette4
oeifrereturn4
reexportsvar4
treiel1exportsreturn4
necalltexportsttexportsotl0texportsomnocrodfunctionetnooetobjectdefinepropertyetenumerable0getnorfunctioneundefinedtypeof4
symbolsymboltostringtagobjectdefinepropertyesymboltostringtagvaluemoduleobjectdefinepropertyeesmodulevalue0otfunctionteif1etot8ereturn4
tif4eobjecttypeof4
tttesmodulereturn4
tvar4
nobjectcreatenullifornobjectdefinepropertyndefaultenumerable0valuet2estringtypeof4
tforvar4
todnrfunctionereturn4
predicted4
chief4
44
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-34
limiting4
six4
6125emfc-container--story-package4
mask4
54
fc-itemfooter--horizontalfc-container--story-package4
free4
fc-item--is-dynamic-cardfc-item--full-media-75-tabletfc-item--has-sublinks-44
likely4
house4
spread4
fc-sublinkfc-container--story-package4
led3
nbspv3
archive3
print3
google3
patrons3
weeks3
app3
rdocumentqueryselectorhtmlodocumentqueryselectorbodyrstyleoverflowhiddenrstylemargin0pxrstylepadding0pxostyleoverflowhiddenostylemargin0pxostylepadding0pxifwindowframeelementwindowframeelementclasslistcontainsinteractive-atom-fencevar3
paris3
idocumentqueryselectorhtmlldocumentqueryselectorbodylclasslistaddge-liveblogistyleoverflowhiddenistylepadding0istylemargin0lstyleoverflowhiddenlstylepadding0lstylemargin0settimeoutfunctionwindowresize1003
spanios3
cannabis3
campaign3
isle3
fc-trailcountfc-trailcount--commentcountsectionfc-container--sombre-palette3
fc-trailcountfc-trailcount--commentcountsectionfc-container--long-running-palette3
fc-item--pillar-news3
profit3
social3
inline-play3
met3
youtube-media-atomplay-button3
wight3
marcus3
following3
west3
death3
around3
investigation3
those3
min-width30emgv-corona-overview3
results3
want3
final3
men3
element-interactivecontentmain-column--interactive3
estonia3
excels3
learning3
life3
show3
experiences3
schools3
hear3
traffic3
people3
sheep3
illuminated3
pumpkins3
trust3
gardens3
female3
education3
science3
worlds3
explore3
recipes3
black3
securedropios3
know3
black-history-timeline3
3s3
games3
hot3
tech3
tennis3
months3
rugby3
letters3
obituaries3
ways3
sees3
min-width6125emgv-corona-overview3
fc-trailcountfc-trailcount--commentcountsectionfc-container--investigation-palette3
meals3
fc-trailcountfc-trailcount--commentcountsectionfc-container--breaking-palette3
sectionletters-treat3
rules3
automedia3
1s3
experience3
5px3
h13
growing3
france3
fc-item--is-dynamic-cardfc-item--is-boosted3
joy3
writers3
treatscontainer3
relative3
12px3
left3
prevent3
barbara3
arent3
struggle3
outside3
supremacist3
extremism3
states3
part3
american3
blue3
hours3
protest3
streets3
ever3
here3
making3
figures3
them3
horror3
140px3
due3
brothers3
businesses3
coverage3
things3
providing3
decisive3
season3
military3
country3
editors3
say3
stay3
coming3
cornwall3
treturn3
min-width8125embodynothas-active-pageskin3
humanity3
club3
european3
block3
head3
warns3
min-width6125em3
14px3
risk3
element-atomcontentmain-column--interactive3
japan3
amazon3
children3
p3
culture-nuggetbuttons3
culture-nuggetarrow3
right3
team3
look3
across3
jams3

Who hosts Theguardian.com?

Theguardian.com Hosting Provider Information

Hosted IP Address:151.101.1.111
Hosted Hostname:151.101.1.111
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Varnish

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Consortium GARR
0.1218%

HTTP Header Analysis for Theguardian.com

Http-Version: 1.1
Status-Code: 301
Status: 301
Server: Varnish
Retry-After: 0
Content-Length: 0
Location: https://theguardian.com/
Accept-Ranges: bytes
Date: Fri, 30 Oct 2020 12:58:49 GMT
Via: 1.1 varnish
Connection: close
X-Served-By: cache-lcy19238-LCY
X-Cache: HIT
X-Cache-Hits: 0
X-Timer: S1604062729.066076,VS0,VE0

Theguardian.com Domain Nameserver Information

HostIP AddressCountry
dns1.p04.nsone.net 198.51.44.4
dns2.p04.nsone.net 198.51.45.4
dns3.p04.nsone.net 198.51.44.68
dns4.p04.nsone.net 198.51.45.68
ns01.theguardiandns.com 45.54.51.1
ns02.theguardiandns.com 45.54.51.65
ns03.theguardiandns.com 45.54.51.129
ns04.theguardiandns.com 45.54.51.193


Need to find out who hosts Theguardian.com?


Domain Registration (WhoIs) information for Theguardian.com

 Domain Name: theguardian.com
Registry Domain ID: 79632_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2015-11-09T20:10:17Z
Creation Date: 1994-07-06T04:00:00Z
Registrar Registration Expiration Date: 2024-07-05T04:00:00Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Guardian News & Media Limited
Registrant State/Province:
Registrant Country: UK
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=theguardian.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=theguardian.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=theguardian.com
Name Server: DNS1.P04.NSONE.NET
Name Server: DNS2.P04.NSONE.NET
Name Server: DNS3.P04.NSONE.NET
Name Server: DNS4.P04.NSONE.NET
Name Server: NS01.THEGUARDIANDNS.COM
Name Server: NS02.THEGUARDIANDNS.COM
Name Server: NS03.THEGUARDIANDNS.COM
Name Server: NS04.THEGUARDIANDNS.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-10-02T09:00:00Z

Websites with Similar Names

Thegu.network
thegu.network - Registered at Namecheap.com
Theguac.com
theguac.com is coming soon
Theguacamoleiceberg.com
We are UNDER CONSTRUCTION
Theguachunter.com
theguachunter.com

Recently Updated Websites

Unishivaji.com (1 second ago.)Ssugar.chat (2 seconds ago.)Edsoftapps.com (3 seconds ago.)Trademotorcycles.com.au (3 seconds ago.)Libertademocional.net (4 seconds ago.)Ralgiftsolutions.com (5 seconds ago.)Finfg.com (5 seconds ago.)Hole1988.nl (5 seconds ago.)Balajinirogdham.com (5 seconds ago.)Aha.ir (5 seconds ago.)Ignaciozuloaga.com (6 seconds ago.)Refrigerantslider.com (6 seconds ago.)Noagenda.digital (7 seconds ago.)Wp4cloud.com (8 seconds ago.)Varisara.space (8 seconds ago.)Highcountryscentedcandles.com (9 seconds ago.)Bvoicecm.com (9 seconds ago.)Hpenvy.net (9 seconds ago.)Epicycle.com.au (10 seconds ago.)Stunningjewelry.club (10 seconds ago.)Creativejuiceclothing.com (10 seconds ago.)Calcomsolar.com (11 seconds ago.)Rpmcotx.com (11 seconds ago.)Kolikkopelit.land (11 seconds ago.)Visitlasvegas.jp (12 seconds ago.)Quaranteamtutors.com (12 seconds ago.)Thepsychedelicsocialworker.com (13 seconds ago.)Trialoom.com (13 seconds ago.)24hourscleaning.com (14 seconds ago.)21ek.ru (14 seconds ago.)

Recently Searched Keywords

alegi caloriferele (1 second ago.)dc – indus marble (2 seconds ago.)di 060025 kg (3 seconds ago.)buddhist temple (3 seconds ago.)xsmbshare (6 seconds ago.)centerpadding 0px (7 seconds ago.)сбу блокировала незаконные поставки из украины запчастей к авиационной технике (8 seconds ago.)motivation-unlimited (10 seconds ago.)registration free (10 seconds ago.)seeding meaning in utorrent (12 seconds ago.)关于博冠 (12 seconds ago.)stray magic kelly meding (13 seconds ago.)古诗词鉴赏 (14 seconds ago.)selama ini (14 seconds ago.)deckssalonyachten (17 seconds ago.)oreficerie (18 seconds ago.)zeven rcb jersey (18 seconds ago.)vacation rentals wildwood nj pet friendly (19 seconds ago.)сбу блокировала незаконные поставки из украины запчастей к авиационной технике (19 seconds ago.)msci all uae capped index (20 seconds ago.)croptober (22 seconds ago.)xsmb 30 (24 seconds ago.)brahmin caste list (24 seconds ago.)ffb-sub-title-2 ffb-id-ppmf9dd ffb-sub-title-2beforeffb-id-ppmf9dd (25 seconds ago.)our dating success stories (25 seconds ago.)программа самообучения 100 skoda двигатели 1.6 л tdi и 2.0 л tdi с системой впрыска common (26 seconds ago.)border-color757575cpstyle3946 cpcloseimage-2-3946 (27 seconds ago.)komomo 90 counter (29 seconds ago.)crisis amp counseling (31 seconds ago.)cafe bizou (32 seconds ago.)