News, sport and opinion from the Guardian's UK edition | The Guardian

Safety: High trust score
Year Founded: 1994
Global Traffic Rank: 77
Estimated Worth: $209,828,880

Latest news, sport, business, comment, analysis and reviews from the Guardian, the world's leading liberal voice



Domain summary

Last updated
2021-11-17
Domain label
theguardian
Domain extension
com
Domain registered:
1994-07-06
Domain updated:
2021-04-13
Global Traffic Rank
77
Statvoo Rating
A+
Trust Score
High trust score
Estimated worth
$209,828,880
Estimated daily income
$194,286
Estimated monthly income
$5,909,533

Frequently Asked Questions (FAQ)

Q: When was Theguardian.com registered?
A: Theguardian.com was registered 27 years, 10 months, 2 weeks, 5 days, 13 hours, 43 minutes, 23 seconds ago on Wednesday, July 6, 1994.
Q: When was the WHOIS for Theguardian.com last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 1 week, 5 days, 13 hours, 43 minutes, 23 seconds ago on Tuesday, April 13, 2021.
Q: What are Theguardian.com's nameservers?
A: DNS for Theguardian.com is provided by the following nameservers:
  • dns1.p04.nsone.net
  • dns2.p04.nsone.net
  • dns3.p04.nsone.net
  • dns4.p04.nsone.net
  • ns01.theguardiandns.com
  • ns02.theguardiandns.com
  • ns03.theguardiandns.com
  • ns04.theguardiandns.com
Q: Who is the registrar for the Theguardian.com domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Theguardian.com?
A: Theguardian.com ranks 77 globally on Alexa. Theguardian.com has a High trust score, and a Statvoo Rank of A+.
Q: How many people visit Theguardian.com each day?
A: Theguardian.com receives approximately 24,285,714 visitors and 194,285,712 page impressions per day.
Q: What IP address does Theguardian.com resolve to?
A: Theguardian.com resolves to the IPv4 address 151.101.193.111.
Q: In what country are Theguardian.com servers located in?
A: Theguardian.com has servers located in the United States.
Q: What webserver software does Theguardian.com use?
A: Theguardian.com is powered by webserver.
Q: Who hosts Theguardian.com?
A: Theguardian.com is hosted by Consortium GARR in United States.
Q: How much is Theguardian.com worth?
A: Theguardian.com has an estimated worth of $209,828,880. An average daily income of approximately $194,286, which is roughly $5,909,533 per month.

Theguardian.com Reviews

We have 1 review(s) for Theguardian.com

Add your review
Verified United Kingdom

 (2 years ago)
 

"Reputable news"


The Guardian is a reputable news provider, operating within the United Kingdom.

Theguardian.com Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Theguardian.com

H1 Headings

3 :
  1. News, sport and opinion from the Guardian's UK edition
  2. Guardian Labs
  3. Sindicat

H2 Headings

28 :
  1. Palette styles new do not delete
  2. Headlines
  3. Spotlight
  4. Coronavirus
  5. Coronavirus data
  6. Opinion
  7. Editorials & Letters
  8. Sport
  9. Contact the Guardian
  10. Climate crisis
  11. From the UK
  12. Around the world
  13. Today in Focus
  14. Podcast Is Donald Trump plotting to steal the 2024 election?
  15. Listen to previous episodes
  16. Video
  17. Culture
  18. culture-treat
  19. Covid vaccines Are they safe for young people – and what are the side effects?
  20. Missing the kids? How to deal with an empty nest
  21. ‘People want to be useful’ Is the Covid volunteering boom here to stay?
  22. Masks and outdoor gatherings How to stay Covid safe this autumn and winter
  23. Lifestyle
  24. Documentaries
  25. Take part
  26. Explore
  27. Newsletters
  28. In pictures

H3 Headings

119 :
  1. Conservatives Michael Gove backer won £164m in PPE contracts after ‘VIP lane’ referral
  2. Peng Shuai Naomi Osaka expresses ‘shock’ over missing Chinese tennis star
  3. Canada Deadly floods and landslides leave Vancouver port cut off
  4. ‘It’s the little things’ Britney Spears speaks out on life post-conservatorship
  5. Nazism Authorities based their elite schools on top British private schools
  6. Live Business: UK inflation surges to 10-year high of 4.2% as fuel and energy prices soar
  7. Guardian morning briefing Boris Johnson tags on to Labour anti-sleaze motion. Get up to speed quickly
  8. Education Dismay over plan to speed up Ofsted inspections of England schools
  9. Prince Andrew Duke of York’s £1.5m loan paid off by firms linked to Tory donor – report
  10. Empathy Grandmothers may be more connected to grandchildren than own offspring
  11. Hogwarts and all Harry Potter cast return to mark 20th anniversary of first film
  12. Life without EU workers ‘I don’t blame customers for getting annoyed’
  13. 'I lost my career to racism' Azeem Rafiq’s testimony plunges English cricket into crisis
  14. Gaga, Gucci and prison ferrets How true crime conquered the world
  15. A moment that changed me ‘After 102 days in intensive care, I finally came home’
  16. Brazil Amazon beef plan will ‘legalise deforestation’ say critics
  17. A large pile of anticlimaxes Miriam and Alan: Lost in Scotland review
  18. Ireland It can feel like the world’s most spectacular wilderness; the savage beauty of Connemara
  19. Can I give you a call bark? The 'DogPhone' that lets pets ring their owners
  20. Live Pfizer to license Covid pill for poor nations, Beijing tightens entry rules ahead of Olympics
  21. Live Pfizer to license Covid pill for poor nations, Beijing tightens entry rules ahead of Olympics
  22. Pfizer Deal allows generic versions of Covid pill for world’s poor
  23. Pfizer Deal allows generic versions of Covid pill for world’s poor
  24. New Zealand Easing of Covid rules could lead to summer crisis, experts warn
  25. New Zealand Easing of Covid rules could lead to summer crisis, experts warn
  26. 'Key business' JP Morgan chief skips quarantine in Hong Kong
  27. 'Key business' JP Morgan chief skips quarantine in Hong Kong
  28. Starmer has found a fruitful line of attack: fighting Tory corruption is a patriotic duty
  29. Azeem Rafiq’s testimony exposes how power works in cricket – and in Britain
  30. Gambling companies feed on addiction and misery. Why are MPs helping them?
  31. Johnson really cares about creating new jobs – especially if your name is Paul Dacre
  32. Paterson’s fair-weather friends keep well away from the standards debate
  33. The Poland-Belarus border crisis is what happens when humans are treated as weapons
  34. Too many NHS staff are still unvaccinated - this is how we change that
  35. Cartoon Ben Jennings on the stench of sleaze hanging over No 10
  36. The Guardian view Vaccine justice: what the world needs now
  37. The Guardian view Russian troops at Ukraine’s border: Putin’s plan B
  38. Letters The party interests that have stalled Lords reform
  39. Letters Electric cars are not a magic bullet for air pollution
  40. Rafiq’s courage shows Yorkshire and the ECB what a real leader looks like
  41. Premier League Chairman to resign after Newcastle takeover controversy
  42. Wales 1-1 Belgium Moore secures home World Cup play-off in Cardiff
  43. Football Southgate expects ‘no complications’ over new England deal
  44. World Cup roundup Bergwijn and Depay secure Netherlands finals spot
  45. FA Cup roundup Gateshead earn Charlton tie with win at Altrincham
  46. Tennis Raducanu to play at Royal Albert Hall in first match back in Britain
  47. IOC Trans women should not have to reduce testosterone, say new guidelines
  48. ‘A death sentence’ Indigenous climate activists denounce Cop26 deal
  49. Australia Al Gore ‘disappointed’ Scott Morrison didn’t increase 2030 emissions target
  50. Climate crisis Leaders call for pressure on stubborn nations before Cop27
  51. Cop26 China urges developed countries to take the lead in cutting out coal
  52. Liverpool attack Investigators not yet sure if hospital bombing was terrorism
  53. Cybercrime UK fighting epidemic as Russian ransomware attacks increase
  54. Theatre Black talent takes centre stage at Lyric Theatre
  55. Universal credit Ministers ‘lost control of fraud in Covid crisis’
  56. Mental health Every part of justice system fails ill people, inspectors find
  57. Cricket Azeem Rafiq tells MPs that ‘inhuman’ racist abuse cost him playing career
  58. Energy industry Neon Reef and Social Energy become latest UK power suppliers to go bust
  59. Parthenon marbles Return of sculptures is up to British Museum, says No 10
  60. Trevor Smith Police shooting was lawful killing, jury finds
  61. Business Sainsbury’s joins the smart set with checkout-free trial in London
  62. Pike River Bodies found of miners from 2010 New Zealand disaster
  63. Immigration and asylum Most people who risk Channel boat crossings are refugees – report
  64. Spain Visa requirement for UK touring musicians scrapped
  65. Milk money ‘Cow’s milk without cows’ start-up raises $13m in seed funding
  66. France Decathlon stops canoe sales to curb migrant crossings
  67. Nuclear power Bill Gates-backed experimental plant heads to tiny Wyoming city
  68. Germany Approval for controversial Nord Stream 2 gas pipeline suspended
  69. Myanmar Aung San Suu Kyi charged with ‘election fraud and lawless actions’
  70. Technology Israeli firm’s spyware linked to attacks on websites in UK and Middle East
  71. Space Russia admits to anti-satellite missile test but denies ‘dangerous behavior’
  72. What did Cop26 actually achieve? The hope and heartache from Glasgow
  73. Freezing to death The migrants left to die on the Poland-Belarus border
  74. Inside the controversial world of animal testing 'It's not putting lipstick on a kitten'
  75. US How the climate crisis is forcing Americans to relocate
  76. 'We have done more than any government' Indigenous activists on the climate crisis
  77. China's accidental feminist icon The grandma who left an abusive husband for the open road
  78. 'Controlled fury’ Baillie Gifford prize goes to Empire of Pain
  79. ‘Vile desecration’ New version of The Snowman axed after composer’s criticism
  80. ‘She has invaded all our lives’ Tong Yang-tze, the artist making calligraphy cool
  81. Things We Do Not Tell the People We Love by Huma Qureshi review A fine debut
  82. TV tonight Abby McEnany pushes dramedy to the limits – and runs low on nuts
  83. Don’t believe everything you read The pleasures and perils of TV subtitles
  84. Your problems, with Anna Tims My energy firm went bust but it has never repaid my credit
  85. This is Pleasing Harry Styles sets out to ‘dispel the myth of a binary existence’
  86. 3D-printed steak, anyone? Taste-testing this ‘gamechanging’ meat mimic
  87. ‘It’s the biggest open secret out there’ The double lives of white-collar workers with two jobs
  88. Nigel Slater’s midweek dinner Clams, peas and sherry
  89. Sexual healing I’ve got a great new boyfriend – but how can we make the sex better?
  90. Sport Share your experiences of racism and islamophobia
  91. Tell us Are you worried remote working could have a negative effect on your job?
  92. The reader interview Post your questions for Stellan Skarsgård
  93. Churches Have you bought – or sold - a pew?
  94. Analysis Questions persist over how Prince Andrew funded lifestyle
  95. The Pacific project One-third of people in Pacific Islands paid a bribe in the last year, says corruption report
  96. Plantwatch Why it shouldn’t be trees v trains
  97. A £300 monsoon-busting home The Bangladeshi architect fighting extreme weather
  98. Reconstruction after Covid Why we should lower the voting age to six
  99. Veteran objecter Christopher Chope’s history of dissent in the Commons
  100. Guardian morning briefing Sign up and start the day one step ahead
  101. TechScape Our weekly guide to the world of technology
  102. The Guide Sign up for a weekly dose of pop culture
  103. The Fiver Get the Guardian's daily football email
  104. ‘A deep, spiritual connection’ Ancient families of Ivory Coast
  105. Tuesday’s best photos A seal count and a light show
  106. Gliders in Lancashire Model aircraft enthusiasts
  107. Culture Photojournalism print sale to support emerging talent
  108. ‘A Jewish Disneyland’ Miami beach in the 70s
  109. Melbourne fashion and a long wait at the border Monday’s best photos
  110. Naomi Osaka expresses ‘shock’ over missing Chinese tennis star Peng Shuai
  111. ‘It’s the little things’: Britney Spears speaks out on life post-conservatorship
  112. Pacific north-west storm wreaks havoc, with one dead and Vancouver cut off
  113. Harry Potter cast return to Hogwarts to mark 20th anniversary of first film
  114. Grandmothers may be more connected to grandchildren than to own offspring
  115. Michael Gove backer won £164m in PPE contracts after ‘VIP lane’ referral
  116. Prince Andrew’s £1.5m loan paid off by firms linked to Tory donor – report
  117. Miriam and Alan: Lost in Scotland review – a large pile of anticlimaxes
  118. ‘It’s the biggest open secret out there’: the double lives of white-collar workers with two jobs
  119. ‘I don’t blame customers for getting annoyed’: a coffee house owner on life without EU workers

H4 Headings

30 :
  1. Analysis Five Tory MPs and peers who referred firms to VIP lane
  2. Politics PM proposes banning MPs from acting as consultants
  3. Explained MPs who could be affected by consultancy ban
  4. Analysis Five Tory MPs and peers who referred firms to VIP lane
  5. Politics PM proposes banning MPs from acting as consultants
  6. Explained MPs who could be affected by consultancy ban
  7. Biden-Xi talks China and US agree to ease restrictions on journalists
  8. Biden-Xi talks China and US agree to ease restrictions on journalists
  9. In pictures Heavy rains and floods hit British Columbia
  10. ‘Tipping point’ How poor forestry fuels floods and fires in western Canada
  11. In pictures Heavy rains and floods hit British Columbia
  12. ‘Tipping point’ How poor forestry fuels floods and fires in western Canada
  13. HMRC Efforts to recoup £1bn in suspect payouts boosted
  14. Anthony Fauci US can get Covid under control by next year with more jabs
  15. Germany Rules set to be tightened for unvaccinated as cases rise
  16. HMRC Efforts to recoup £1bn in suspect payouts boosted
  17. Anthony Fauci US can get Covid under control by next year with more jabs
  18. Germany Rules set to be tightened for unvaccinated as cases rise
  19. Azeem Rafiq Former player tells MPs of ‘inhuman’ racist abuse
  20. Jonathan Liew Rafiq exposes how power works in cricket and Britain
  21. Reaction Campaigners warn over ‘Kevin’ nickname reported by Rafiq
  22. Azeem Rafiq Former player tells MPs of ‘inhuman’ racist abuse
  23. Jonathan Liew Rafiq exposes how power works in cricket and Britain
  24. Reaction Campaigners warn over ‘Kevin’ nickname reported by Rafiq
  25. The Fiver Sign up and get our daily football email
  26. The Fiver Sign up and get our daily football email
  27. ‘We’ve come a long way' Clarke revels in Scotland progress
  28. ‘We’ve come a long way' Clarke revels in Scotland progress
  29. Jonathan Wilson Balance matters more than romance
  30. Jonathan Wilson Balance matters more than romance

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

83 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-78705427-1

Links - Internal

380:

Links - Internal (nofollow)

0:

Links - Outbound

15:

Links - Outbound (nofollow)

3:

Keyword Cloud for Theguardian.com

search jobsfcitem ufauxblocklinkhoverfcitemiscommentablenotfcitemtypecommentfcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto0625remtransparent 0625remtransparentfccontainerinnerbordertop1pxfcitemmediametaguardianfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinks fcsublinkfcitemliveblogblocktextafterboxshadow3125rem 0ufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125remfcitemfcitemisdynamiccard fctrailcountcommentcount inlineiconfcitem vjsbigplaybuttonfcsublink fcsublinklinksectionfccontainereventaltpalettefcitemhasfloatingsublinksfcitemisdynamiccard fcsublinkfcitem fcitemmediameta inlineiconfcitemmediameta inlineiconfcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9bfcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypelivefcitemfcitemisdynamiccard fctrailcountcommentcountfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinksfcitemclassfcitempillarfcitemtypecommentappfcitem youtubemediaatomplaybutton inlineplay125rem0625remtransparentfcsublinkuk editionfcitemfcitemlivefctodayyoutubemediaatomplaybutton inlineplayfcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypelive fcsublinkfcsublinklinksectionfccontainereventpalettefctrailcountcommentcountswitchfcitem fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9bfootballfcitemfcitem fcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto0 3125remfcitemtitlequotedfcitemfcitemisdynamiccardfcitemliveupdatesfcsublink fcsublinklinksectionfccontainereventpalettefcitempillarnewssearchfcitemliveupdatesfcitemfcitemisdynamiccardnotfcitemhasfloatingsublinks ufauxblocklinkhoverukfcsublinklinksectionfccontainereventaltpalettefcitemmetaminwidthcalc4chfctrailcountfctrailcountcommentcountsectionfccontainerbreakingpalettefcitemliveupdates ufauxblocklinkhoverusfcitem fctrailcountcommentcount inlineiconcontentopinionfctrailcountfctrailcountcommentcountsectionfccontainerlongrunningpalettebottom808a9b808a9b 0625remtransparent 0625remtransparentfcitemisdynamiccard0 3125rem 125reminlineiconampfcitemtypecommentfcitemhasfloatingsublinksfcitemisdynamiccardclassfcitemhassublinkssolidfcitemliveblogblocktextafterboxshadow3125remyoutubemediaatomplaybuttonfcitemfcitemtypecommentfcitemhascutoutfcitemfcitemisdynamiccard ufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125remufauxblocklinkhover fcitemliveblogblocktextafterboxshadow3125rem 0fcitemiscommentablenotfcitemtypecomment fcitemmetaminwidthcalc4chfcitemfcitemisdynamiccard fcitemliveblogblocktextafterboxshadow3125rem 0editionfcitem fcsublinktitleinlineplayfcitemlivenewsfctrailcountfctrailcountcommentcountsectionfccontainersombrepalettefctrailcountcommentcount inlineiconsportjobs3125remfccontainerheadertitlefcitemfcitemisdynamiccardfcitemtypecommentnotfcitempillarspecialreportfcitemliveblogblocktextafterboxshadow3125rem 0 3125remfcitemfcitemisdynamiccard fcitemliveblogblocktextafterboxshadow3125remfcitemfcitemisdynamiccardfcitemlivefccontainerinnerbordertop1px solidfcitemfcitemtypecommentnotfcitempillarspecialreportfcitemfcitemisdynamiccard3125rem 125remufauxblocklinkhoverfcitemtypelive fcsublinkfcitem youtubemediaatomplaybuttonfcitem fctrailcountcommentcount0bottom808a9b808a9bedition switchfcitemfcitemisdynamiccard ufauxblocklinkhoverfcitemfcitemisdynamiccardfcitemliveupdates ufauxblocklinkhoverfcitem fcsublinkfcitemfcitemisdynamiccardclassfcitempillarfcitemtypecommentbottom808a9b808a9b 0625remtransparentfctrailcountfctrailcountcommentcountsectionfccontainerinvestigationpalettefcitem fcitemmediametavjsbigplaybuttonfcsublinktitlefcitemfcitemisdynamiccardfcitempillarnewsfcitemfcitemisdynamiccard fcitemtitlequotedfcitemcontainerfcitemmetabackgroundimagerepeatinglineargradientto bottom808a9b808a9b 0625remtransparentfcitemhasfloatingsublinksfcitemisdynamiccardfcitemtypelive

Longtail Keyword Density for Theguardian.com

KeywordsOccurences
0 3125rem -125rem26
fc-itemliveblog-blocktextafterbox-shadow-3125rem 0 3125rem26
u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem 013
fc-item fc-itemmedia-meta inline-icon12
fc-item fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b 0625remtransparent6
bottom808a9b808a9b 0625remtransparent 0625remtransparent6
fc-itemfc-item--is-dynamic-card fc-itemliveblog-blocktextafterbox-shadow-3125rem 06
fc-itemfc-item--is-dynamic-card u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem6
fc-itemfc-item--is-dynamic-card fc-trailcount--commentcount inline-icon4
fc-item fc-trailcount--commentcount inline-icon3
fc-item youtube-media-atomplay-button inline-play3
0 3125rem26
3125rem -125rem26
fc-itemliveblog-blocktextafterbox-shadow-3125rem 026
fc-itemfc-item--is-dynamic-card u-faux-block-link--hover24
fc-item fc-itemmedia-meta18
fc-item u-faux-block-link--hover18
u-faux-block-link--hover fc-itemliveblog-blocktextafterbox-shadow-3125rem13
fc-itemmedia-meta inline-icon12
fc-containerinnerborder-top1px solid12
fc-item--has-floating-sublinksfc-item--is-dynamic-card fc-sublink10
fc-itemfc-item--is-dynamic-card fc-trailcount--commentcount8
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks fc-sublink8
fc-trailcount--commentcount inline-icon7
fc-item vjs-big-play-button6
fc-item--is-commentablenotfc-item--type-comment fc-itemmetamin-widthcalc4ch6
fc-item--type-live fc-sublink6
fc-item--live-updates u-faux-block-link--hover6
0625remtransparent 0625remtransparent6
fc-itemfc-item--is-dynamic-card fc-itemliveblog-blocktextafterbox-shadow-3125rem6
bottom808a9b808a9b 0625remtransparent6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto bottom808a9b808a9b6
fc-item fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto6
fc-item fc-sublinktitle6
fc-itemfc-item--is-dynamic-cardfc-item--live-updates u-faux-block-link--hover6
fc-item fc-trailcount--commentcount6
fc-item fc-sublink6
edition switch6
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks u-faux-block-link--hover6
fc-item--has-floating-sublinksfc-item--is-dynamic-cardfc-item--type-live fc-sublink4
fc-itemfc-item--is-dynamic-card fc-itemtitle--quoted4
uk edition4
fc-sublink fc-sublinklinksectionfc-container--event-alt-palette3
fc-sublink fc-sublinklinksectionfc-container--event-palette3
youtube-media-atomplay-button inline-play3
fc-item youtube-media-atomplay-button3
search jobs3
fc-item119
fc-itemfc-item--is-dynamic-card116
u-faux-block-link--hover75
fc-sublink34
fc-itemliveblog-blocktextafterbox-shadow-3125rem26
026
3125rem26
-125rem26
fc-itemfc-item--is-dynamic-cardfc-item--live-updates24
fc-item--has-floating-sublinksfc-item--is-dynamic-card22
inline-icon19
fc-itemmedia-meta18
fc-itemfc-item--is-dynamic-cardnotfc-item--has-floating-sublinks18
fc-itemfc-item--live18
fc-item--live-updates16
fc-itemtitle--quoted16
guardian14
fc-trailcount--commentcount14
fc-itemfc-item--is-dynamic-cardfc-item--live12
fc-containerinnerborder-top1px12
fc-item--has-floating-sublinksfc-item--is-dynamic-cardclassfc-item--has-sublinks12
0625remtransparent12
solid12
edition11
fc-containerheadertitle10
fc-item--has-floating-sublinksfc-item--is-dynamic-cardfc-item--type-live10
uk8
switch7
amp7
fc-itemclassfc-item--pillar-fc-item--type-comment7
fc-itemfc-item--is-dynamic-cardfc-item--pillar-news6
fc-itemmetamin-widthcalc4ch6
fc-item--is-commentablenotfc-item--type-comment6
vjs-big-play-button6
fc-itemfc-item--is-dynamic-cardfc-item--type-commentnotfc-item--pillar-special-report6
fc-item--type-live6
fc-itemfc-item--is-dynamic-cardclassfc-item--pillar-fc-item--type-comment6
fc-itemcontainerfc-itemmetabackground-imagerepeating-linear-gradientto6
fc-item--live6
fc-itemfc-item--type-commentnotfc-item--pillar-special-report6
search6
bottom808a9b808a9b6
fc-sublinktitle6
fc-today6
fc-item--type-comment6
fc-itemfc-item--type-commentfc-item--has-cutout6
jobs5
news5
opinion4
fc-sublinklinksectionfc-container--event-alt-palette4
fc-sublinklinksectionfc-container--event-palette4
fc-trailcountfc-trailcount--commentcountsectionfc-container--breaking-palette3
fc-trailcountfc-trailcount--commentcountsectionfc-container--investigation-palette3
fc-trailcountfc-trailcount--commentcountsectionfc-container--sombre-palette3
fc-item--is-dynamic-card3
app3
football3
sport3
youtube-media-atomplay-button3
inline-play3
us3
fc-item--pillar-news3
fc-trailcountfc-trailcount--commentcountsectionfc-container--long-running-palette3
content3

Who hosts Theguardian.com?

Theguardian.com Hosting Provider Information

Hosted IP Address:151.101.193.111
Hosted Hostname:151.101.193.111
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
Consortium GARR
0.0954%

HTTP Header Analysis for Theguardian.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Length: 196888
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
ETag: W/"hash-3973221981617313976"
Link:; rel=preload; as=style; nopush,; rel=preload; as=script; nopush,; rel=preload; as=script; nopush
Accept-Ranges: bytes
Date: Wed, 17 Nov 2021 07:36:34 GMT
Age: 6
X-Timer: S1637134594.392404,VS0,VE1
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Content-Security-Policy: default-src https:; script-src https: 'unsafe-inline' 'unsafe-eval' blob: 'unsafe-inline'; frame-src https: data:; style-src https: 'unsafe-inline'; img-src https: data: blob:; media-src https: data: blob:; font-src https: data:; connect-src https: wss:; child-src https: blob:; object-src 'none'; base-uri https://*.gracenote.com
Referrer-Policy: no-referrer-when-downgrade
Feature-Policy: camera 'none'; microphone 'none'; midi 'none'; geolocation 'none'
Permissions-Policy: camera=(), microphone=(), midi=(), geolocation=(), interest-cohort=()
X-GU-Edition: uk
Cache-Control: max-age=60, stale-while-revalidate=6, stale-if-error=864000, private, no-transform
Vary: Accept-Encoding,User-Agent

Theguardian.com Domain Nameserver Information

HostIP AddressCountry
dns1.p04.nsone.net 198.51.44.4
dns2.p04.nsone.net 198.51.45.4
dns3.p04.nsone.net 198.51.44.68
dns4.p04.nsone.net 198.51.45.68
ns01.theguardiandns.com 45.54.51.1
ns02.theguardiandns.com 45.54.51.65
ns03.theguardiandns.com 45.54.51.129
ns04.theguardiandns.com 45.54.51.193


Need to find out who hosts Theguardian.com?


Domain Registration (WhoIs) information for Theguardian.com

 Domain Name: theguardian.com
Registry Domain ID: 79632_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-15T17:47:00Z
Creation Date: 1994-07-05T23:00:00Z
Registrar Registration Expiration Date: 2025-07-04T23:00:00Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registrant Organization: Guardian News & Media Limited
Registrant State/Province:
Registrant Country: GB
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=theguardian.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=theguardian.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=theguardian.com
Name Server: DNS1.P04.NSONE.NET
Name Server: DNS2.P04.NSONE.NET
Name Server: DNS3.P04.NSONE.NET
Name Server: DNS4.P04.NSONE.NET
Name Server: NS01.THEGUARDIANDNS.COM
Name Server: NS02.THEGUARDIANDNS.COM
Name Server: NS03.THEGUARDIANDNS.COM
Name Server: NS04.THEGUARDIANDNS.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-11-17T07:36:53Z

Websites with Similar Names

Thegu.network
thegu.network - Registered at Namecheap.com
Theguac.com
theguac.com is coming soon
Theguacamoleiceberg.com
We are UNDER CONSTRUCTION
Theguachunter.com
theguachunter.com

Recently Updated Websites

Plombier-20e-paris.com (3 minutes 27 seconds ago.)Outdoorproductsreview.com (10 minutes 11 seconds ago.)Weshareinsight.com (21 minutes 40 seconds ago.)Mitrabotol.com (47 minutes 31 seconds ago.)Idolagacor.com (48 minutes 6 seconds ago.)Worldidol.online (49 minutes 18 seconds ago.)Fabol.org (50 minutes 4 seconds ago.)Akujenius.site (50 minutes 39 seconds ago.)Nivogradnja.hr (1 hour 24 seconds ago.)Electricianalbuquerquenm.com (1 hour 53 seconds ago.)Shubhweddingplace.com (1 hour 5 minutes ago.)Promofreebet.org (1 hour 21 minutes ago.)Bettingguide.com (1 hour 23 minutes ago.)Mlr.in (1 hour 23 minutes ago.)Dirtyboat.com (1 hour 26 minutes ago.)Ssrmovies.bar (1 hour 31 minutes ago.)Vegoltvapk.com (1 hour 32 minutes ago.)Bel.postcodebase.com (1 hour 33 minutes ago.)Agrofocus.pl (1 hour 54 minutes ago.)Houseofshrooms.co (2 hours 3 minutes ago.)Reblogme.com (2 hours 26 minutes ago.)Newtumbl.com (2 hours 26 minutes ago.)I-olympiada.gr (2 hours 43 minutes ago.)Brandschutz-zentrale.de (2 hours 46 minutes ago.)Pulliam247.com (2 hours 58 minutes ago.)Mambiznes.com.pl (3 hours 2 minutes ago.)Alhijaztours.net (3 hours 4 minutes ago.)Apuestasdeportivaschile.com (3 hours 9 minutes ago.)Apostarenlinea.cl (3 hours 11 minutes ago.)Okemossmilecenter.com (3 hours 12 minutes ago.)

Recently Searched Keywords

ações e programas (2 seconds ago.)地基强夯 (2 seconds ago.)italian cooking (3 seconds ago.)interest on your (5 seconds ago.)מטיל (5 seconds ago.)מסחר bvse (5 seconds ago.)עבור ישויות משפטיות (5 seconds ago.)uks fastest growing (5 seconds ago.)נפח (5 seconds ago.)chaptalization is (6 seconds ago.)lifehacker apps 2020 (6 seconds ago.)ניתן לביטול במטבע חוץ (6 seconds ago.)shoutaboutmedia (6 seconds ago.)u003eu003cbr (6 seconds ago.)פינסק (6 seconds ago.)פִּרסוּם (7 seconds ago.)ממיר מטבע (7 seconds ago.)pasas (7 seconds ago.)voluptuous (7 seconds ago.)מימון מחדש של הלוואות (8 seconds ago.)cu cho (8 seconds ago.)מחשבון אג (8 seconds ago.)opalanie w ogrodzie – jakie kosmetyki stosować, żeby opalenizna była piękna i trwała (9 seconds ago.)تويتر (9 seconds ago.)hindi pdf (9 seconds ago.)eventos de hoy (10 seconds ago.)allurebeauty.pk (11 seconds ago.)crazypraisy.com (12 seconds ago.)opacity00 background 131313 (13 seconds ago.)get drainage help in nashville tn areas. (13 seconds ago.)