|  Website Templates | WordPress Themes | ThemeForest
High trust score  | 
The #1 marketplace for premium website templates, including themes for WordPress, Magento, Drupal, Joomla, and more. Create a website, fast. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:A
Alexa Rank Alexa Rank:344
Majestic Rank Majestic Rank:203
Domain Authority Domain Authority:98%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: MARKMONITOR INC.
Registration Date:2007-11-27  1 decade 1 year 1 month ago
Last Modified:2013-05-28  5 years 7 months 2 weeks ago
Expiration Date:2021-11-27  2 years 10 months 4 days from now

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: 1342683396_DOMAIN_NET-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2015-08-25T12:32:37Z
Creation Date: 2007-11-27T03:49:29Z
Registry Expiry Date: 2021-11-27T03:49:29Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverDeleteProhibited
Domain Status: serverTransferProhibited
Domain Status: serverUpdateProhibited
Name Server: A1-93.AKAM.NET
Name Server: A12-64.AKAM.NET
Name Server: A13-65.AKAM.NET
Name Server: A16-66.AKAM.NET
Name Server: A4-67.AKAM.NET
Name Server: A9-64.AKAM.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-16T00:04:11Z

Who hosts is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4997
Location Longitude:-98.3992
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Fri, 22 May 2015 17:27:07 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
X-UA-Compatible: IE=Edge,chrome=1
ETag: "1f28f28b5fa4e46b8d85dd46043e03fc"
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: 08ff3595e12f953d899114c10b67934c
X-Runtime: 0.305265
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

noneunlimitedtrue useeventmobile nonprofitldrupalwehitemstechnologyouroutpsdnyou canfontweight 500cmsheaderstripbuilder3doceantrue elsetsrcelementweb designundefinedretailvarsendmobileall itemsampglobalmusepopular filessitetypeenginelearntypeengine themeshelpsketchdesignsearchpageviewpopular items allnewneedanalyticstrue useevent truemaxwidthcategoriesnonprofitall categoriesour communityenvato marketgraphicrivertemplates popularitems allpageshrefweddingpersonalcanpluginscwpmaketopunlimited downloadselse ifvar rcolor whitegoogleefalse2wordpress pluginsforumscorporate creativeupautotechnology weddinganalyticssuffixlanding pagesclick50pxc oe tcorporatedesignerblogginggetentertainment0utrueonefunctionemediafunctione twedding miscellaneousviewheightdisplayif newwebsitestextdecoration nonefree tutorialselsetop newtemplatesgatrequiretrue else ifmarketrighteasycodecanyonfollowtemplates sketchwordpressjoomlaauthorsclick c oweb designeryouifrealabsolutecourseswidthenvatoo return truesketch templatesrun trueletterspacingrun true useeventreturn true elsethemeforesttemplates sketch templatesreturnuseevent truewhiteposition absoluteecommercecollectionscolorcommunityclick creturn truewebsite templatesgatsendmarketingbloglandingheaderstriptextwebsitet n3tutorialsvideohiveshopify1pagescenteritems all itemswebmiscellaneous musebackgroundcolorfreedownloadshelp youpopular itemswindowenvisrunningsthemestextdecorationsignrunweekfontweightuseeventaudiojunglerfunctionpositioneveryweb templatessomecreativedigitalheight 50pxmiscellaneoustalleducationmarginhtmlpopularpsd templatestechnology wedding miscellaneousyourfontsizewoocommercemorefeaturedfileso returnocart

Longtail Keyword Density for

return true else6
popular items all6
items all items6
true else if5
o return true4
click c o4
templates sketch templates4
technology wedding miscellaneous4
run true useevent3
true useevent true3
popular items12
else if9
all items9
return true8
true else6
items all6
psd templates6
corporate creative6
sketch templates6
click c5
envato market4
all categories4
text-decoration none4
useevent true4
o return4
if new4
c o4
position absolute4
free tutorials4
website templates4
font-weight 5004
templates popular4
wedding miscellaneous4
landing pages4
miscellaneous muse4
templates sketch4
technology wedding4
typeengine themes4
mobile nonprofit4
top new4
run true3
e t3
true useevent3
popular files3
t n3
wordpress plugins3
web designer3
our community3
unlimited downloads3
web templates3
height 50px3
you can3
web design3
functione t3
color white3
help you3
var r3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States DNS Record Analysis DNS Lookup

Serial: 1
Refresh: 7200
Retry: 900
Expire: 1209600
themeforest.netMX86400Priority: 1
themeforest.netMX86400Priority: 10
themeforest.netMX86400Priority: 10
themeforest.netMX86400Priority: 10
themeforest.netMX86400Priority: 10
themeforest.netMX86400Priority: 5
themeforest.netMX86400Priority: 5
themeforest.netTXT86400TXT: v=spf1 ?all

Alexa Traffic Rank for

Alexa Search Engine Traffic for