Themeforest.net  |  Website Templates | WordPress Themes | ThemeForest
High trust score  | 
The #1 marketplace for premium website templates, including themes for WordPress, Magento, Drupal, Joomla, and more. Create a website, fast.

Themeforest.net Website Information

Themeforest.net has a High trust score, a Statvoo Rank of A, an Alexa Rank of 344, a Majestic Rank of 203, a Domain Authority of 98% and is not listed in DMOZ.

Themeforest.net is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Themeforest.net has an IP Address of 23.253.198.38 and a hostname of 23.253.198.38.

The domain themeforest.net was registered 1 decade 1 year 10 months ago by MARKMONITOR INC., it was last modified 6 years 4 months 2 weeks ago and currently is set to expire 2 years 1 month 1 week from now.


Whois information for themeforest.net

Full Whois Lookup for Themeforest.net Whois Lookup

Domain Name: THEMEFOREST.NET
Registry Domain ID: 1342683396_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2015-08-25T12:32:37Z
Creation Date: 2007-11-27T03:49:29Z
Registry Expiry Date: 2021-11-27T03:49:29Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: serverDeleteProhibited https://icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited https://icann.org/epp#serverUpdateProhibited
Name Server: A1-93.AKAM.NET
Name Server: A12-64.AKAM.NET
Name Server: A13-65.AKAM.NET
Name Server: A16-66.AKAM.NET
Name Server: A4-67.AKAM.NET
Name Server: A9-64.AKAM.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-16T00:04:11Z

Who hosts Themeforest.net?

Themeforest.net Web Server Information

Hosted IP Address:23.253.198.38
Hosted Hostname:23.253.198.38
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4997
Location Longitude:-98.3992
Webserver Software:Not Applicable

HTTP Header Analysis for Themeforest.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Fri, 22 May 2015 17:27:07 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
X-UA-Compatible: IE=Edge,chrome=1
ETag: "1f28f28b5fa4e46b8d85dd46043e03fc"
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: 08ff3595e12f953d899114c10b67934c
X-Runtime: 0.305265
Content-Encoding: gzip


Need to find out who hosts Themeforest.net?

Themeforest.net Free SEO Report

Website Inpage Analysis for Themeforest.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Themeforest.net

musewpautosomefontweightgraphicriverreturn truethemeforestheighttrue elseweb designerblogt ndesignpluginspopularrun true useeventlanding pagesthemestsrcelementwindowenvisrunningsitefeaturedtutorialsunlimited downloadsouttechnologynonefunctionyourourenvato marketmiscellaneous museampc oogatrequiremaxwidthcwebtypeengineuseevent truecollectionstrue useeventcommunitybloggingeveryrightscoloryou canour community50pxmarketingreturn true elsevar rdesignertruewebsite templatesrunwedding miscellaneousnonprofitlmediawebsitehelp youcartdisplayeducationpsdcorporate creativeall itemspopular itemsitems all itemsenvatotextdecoration nonepositionclick c ocreativemarketnrun truedigitalfalseheaderstriptextauthorsvaritems allletterspacing3doceanlandingneedcoursestechnology wedding miscellaneoussearchfunctione tbackgroundcolorreturndownloadsweddingsendfontweight 500top newmarginfreemakeviewo returntechnology weddingdrupalwordpress pluginsgooglecenterpagesitemsmobileifaudiojungleoneabsoluteentertainmentpageretailall categoriesheight 50pxwidthtemplates popularelsewordpresstextdecorationpopular items alltemplates sketchweallcorporatemore1web templateswoocommerce0clickif newunlimitedweb designsketch templatestemplateswebsitescmscolor whitehtmlelse iffiles3canheaderstriplearn2shreftopfollowpsd templatesgetbuilderhelpundefinedwhitejoomlaanalyticssuffixnewgatsendforumseasyshopifyttrue useevent trueo return truemobile nonprofitsketchfunctionepersonalyoutemplates sketch templatescategoriessigne tmiscellaneouspopular filesposition absoluteuweekclick cfontsizecodecanyonupvideohivefree tutorialsecommercetrue else ifanalyticsrpageviewetypeengine themesglobalhrealuseevent

Longtail Keyword Density for Themeforest.net

KeywordsOccurences
return true else6
popular items all6
items all items6
true else if5
o return true4
click c o4
templates sketch templates4
technology wedding miscellaneous4
run true useevent3
true useevent true3
popular items12
else if9
all items9
return true8
true else6
items all6
psd templates6
corporate creative6
sketch templates6
click c5
envato market4
all categories4
text-decoration none4
useevent true4
o return4
if new4
c o4
position absolute4
free tutorials4
website templates4
font-weight 5004
templates popular4
wedding miscellaneous4
landing pages4
miscellaneous muse4
templates sketch4
technology wedding4
typeengine themes4
mobile nonprofit4
top new4
run true3
e t3
true useevent3
popular files3
t n3
wordpress plugins3
web designer3
our community3
unlimited downloads3
web templates3
height 50px3
you can3
web design3
functione t3
color white3
help you3
var r3
templates36
if30
var28
027
items25
true19
popular19
themes19
all17
new16
you14
our14
return14
wordpress13
envato13
o12
headerstrip11
else11
web10
t10
miscellaneous10
top10
n10
community10
forums9
your9
codecanyon9
creative9
tutorials9
c8
more8
courses8
free8
ecommerce8
color8
pages7
help7
files7
themeforest7
psd6
u6
muse6
design6
site6
position6
r6
amp6
corporate6
landing6
categories6
none6
sketch6
function6
font-weight6
learn5
plugins5
authors5
50px5
headerstrip-text5
auto5
click5
text-decoration5
market5
website5
one5
cms5
google5
downloads5
width4
false4
e4
run4
useevent4
pageview4
gatrequire4
some4
can4
need4
14
absolute4
cart4
blogging4
typeengine4
mobile4
drupal4
digital4
entertainment4
wp4
technology4
featured4
marketing4
wedding4
retail4
height4
html4
nonprofit4
right4
personal4
education3
analyticssuffix3
page3
gatsend3
windowenvisrunning3
real3
follow3
graphicriver3
3docean3
shref3
l3
audiojungle3
h3
videohive3
tsrcelement3
search3
functione3
blog3
collections3
23
send3
s3
undefined3
up3
center3
sign3
display3
media3
shopify3
e-commerce3
letter-spacing3
font-size3
margin3
max-width3
white3
background-color3
unlimited3
view3
easy3
designer3
make3
get3
33
analytics3
builder3
out3
joomla3
global3
woocommerce3
week3
every3
we3
websites3

What are the nameservers for themeforest.net?

Themeforest.net Domain Nameserver Information

HostIP AddressCountry
ns-1253.awsdns-28.org 205.251.196.229United States United States
ns-1967.awsdns-53.co.uk 205.251.199.175United States United States
ns-300.awsdns-37.com 205.251.193.44United States United States
ns-590.awsdns-09.net 205.251.194.78United States United States

Themeforest.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Themeforest.net is a scam?