— Secure

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-10
Domain label
thestew
Domain extension
us
Domain registered:
2000-06-10
Domain updated:
2021-05-10
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Thestew.us registered?
A: Thestew.us was registered 21 years, 5 days, 10 hours, 51 minutes, 49 seconds ago on Saturday, June 10, 2000.
Q: When was the WHOIS for Thestew.us last updated?
A: The WHOIS entry was last updated 1 month, 5 days, 10 hours, 51 minutes, 49 seconds ago on Monday, May 10, 2021.
Q: What are Thestew.us's nameservers?
A: DNS for Thestew.us is provided by the following nameservers:
  • ns-cloud-e2.googledomains.com
  • ns-cloud-e3.googledomains.com
  • ns-cloud-e1.googledomains.com
  • ns-cloud-e4.googledomains.com
Q: Who is the registrar for the Thestew.us domain?
A: The domain has been registered at NEUSTAR INC..
Q: What is the traffic rank for Thestew.us?
A: Thestew.us has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Thestew.us each day?
A: Thestew.us receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Thestew.us resolve to?
A: Thestew.us resolves to the IPv4 address 198.49.23.145.
Q: In what country are Thestew.us servers located in?
A: Thestew.us has servers located in the United States.
Q: What webserver software does Thestew.us use?
A: Thestew.us is powered by Squarespace webserver.
Q: Who hosts Thestew.us?
A: Thestew.us is hosted by SQUARESPACE in United States.
Q: How much is Thestew.us worth?
A: Thestew.us has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Thestew.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Thestew.us Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Thestew.us

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Thestew.us

vimeoscreen and maxwidth600pxsqsslidewrapperdataslidetypelockscreensqsslidewrapperdataslidetypelockscreen dataslicetypebuttons5pxbuttonsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons dropboxdataslicetypesocialicons linkedinuseiconfillff4500sqsslidewrapperdataslidetypelockscreendataslicetypetwitter tweetavatariconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutresponsivewrapperstacked dataslicetypebuttonsrsssocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsdataslicetypealbum trackprogressbarlightboxinnericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliddataslicetypebuttons li ahoversqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackeddataslicetypesocialiconshover instagramhoverdataslicetypealbum sqsslicealbumplaylist tracksbuttonstyleoutlinesocialstackedtextalignlefteaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolordataslicetypesocialiconshover applepodcastsqsalbumminimal dataslicetypealbumsocialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover foursquarehoveruseiconfill1ab7easqsslidewrapperdataslidetypelockscreen4pxahoversqsslidewrapperdataslidetypelockscreendribbblehoversqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderuseiconfille0393esqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle2s easeintransitionopacity 2seaseinoutmstransitionbackgroundcolorgithubhoverfivehundredpixhoveractionssqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover twitterhoverdataslicetypesocialiconshover dribbblesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover bandsintownhovertweetbodydataslicetypealbum sqsslicealbumplayliststacked0px 0pxsocialiconssizeextrasmallsocialiconsstylesolidlockstyleregularfacebookuseiconfill35465dsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover googleplayhoverdataslicetypesocialiconshover squarespacethedotshoverdataslicetypesocialicons facebookiconwrapperwidth32pxheight32pxmargin0useiconfill00ab6csqsslidewrapperdataslidetypelockscreenstitcherhoverbuttonplaypausefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxlightboxinner lightboxcontentdataslicetypesocialicons rdiouseiconfill55aceesqsslidewrapperdataslidetypelockscreenemailhover1s3pxdataslicetypebody psocialiconssizeextrasmallsocialiconsstyleknockoutsocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen2s easeinotransitionopacity 2sdataslicetypesocialiconshover rssuseiconfill4183c4sqsslidewrapperdataslidetypelockscreenneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vinehoverdataslicetypesocialicons vevolisqsslidewrapperdataslidetypelockscreendataslicetypesocialicons stitcheruseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypealbum sqsslicealbumplaylistbordercolor 170mslockstyleborder dataslicetypelockdataslicetypesocialiconshover bandsintownusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockouticonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutuseiconfillea4c89sqsslidewrapperdataslidetypelockscreengoodreadshoverdataslicetypesocialiconshover soundcloudsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftdataslicetypebuttons ulsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons twitterspansqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautoeaseintransitionopacity 2ssocialiconssizelargesocialiconsstyleknockoutsoundcloudhoversocialiconssizeextralargesocialiconsstyleregularpasswordstylerectanglesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedsocialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialicons tumblryoutubehover170msdataslicetypesocialiconshover soundcloudhovervevop ahoversqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody pdataslicetypesocialicons vineuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborderuseiconfille6b91esqsslidewrapperdataslidetypelockscreenemailulstackedsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlinesocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover spotifyhoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonseaseinoutsqsalbumminimaleaseintransitionopacitysqsslidesqsslideanimationreadyonlyhouzzsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactioninputwrappernothiddenformitemsqsslidewrapperdataslidetypelockscreenformwrapper inputtypesubmithoversqsslidewrapperdataslidetypelockscreenuseiconfilleb4924sqsslidewrapperdataslidetypelockscreenvideoiconstyleregularuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinotransitionopacity 2seaseinoutotransitionbackgroundcolorsocialstackedtextalignleft dataslicetypesocialiconsaudioplayericonsstyleknockout170ms easeinout bordercolorsqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideindataslicetypesocialiconshover rdiohover2s easeintransitionopacitydataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialicons goodreadsactionsnotstackeddataslicetypesocialiconshover ituneshoveruseiconfillc41200sqsslidewrapperdataslidetypelockscreenformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreencountdownunitmaxwidth600pxsqsslidewrapperdataslidetypelockscreenreddithoversocialiconsstylesolid dataslicetypesocialiconshover2s easeinmoztransitionopacity 2sinstagramhoverredditsocialiconsstyleknockout dataslicetypesocialicons170ms easeoutopacity 170msdataslicetypesocialicons spotifysqsmodallightboxcontent lightboxinnerul lisqsslidewrapperdataslidetypelockscreensocialiconssizelargesocialiconsstylesolidsnapchatsocialiconscolorstandardsocialiconsstyleregulartweettimestampflickrhoverbandsintownuseiconfilltransparentsqsslidewrapperdataslidetypelockscreeniconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypealbum iconwrappericonwrapperhoverpinterestp asqsslidewrapperdataslidetypelockscreendataslicetypebuttons ul lisqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover googlehoverneuearialsansseriffontsize14pxlineheight13emtexttransformnoneletterspacing05emfontweightnormalfontstylenormalcolor3a3a3asqsslidewrapperdataslidetypelockscreensocialiconssizelargesocialiconsstyleregulargalleryvideobackgroundsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrappericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialiconshover stumbleuponhoverdataslicetypesocialiconshover vevobuttonstyleoutline dataslicetypebuttonseaseinmstransitionopacity 2ssqsslicecustomform ahoversqsslidewrapperdataslidetypelockscreen0socialstacked dataslicetypesocialiconsdataslicetypetwittersqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypelockscreenbordercolorsqsmodallightboxopendataslicetypesocialiconshover flickrhoverdataslicetypesocialicons youtubesqsslicealbumplaylistdemoalbumresponsivewrapperstackedtextaligncenterdataslicetypepassworduseiconfillf94877sqsslidewrapperdataslidetypelockscreendataslicetypenavigation ulsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesocialiconssizemediumsocialiconsstylesolidbuttonstyleoutline datacompoundtypepopupoverlayactiongoogleplayhoversocialiconscolorstandardsocialiconsstylesolidli asqsslidewrapperdataslidetypelockscreenuseiconfillcc2127sqsslidewrapperdataslidetypelockscreenvinehoverresponsivewrapperstackeduseiconfill8c8070sqsslidewrapperdataslidetypelockscreentweetavatarbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover codepenhoversqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperactionsstackeddataslicetypemap170ms easeinouttransitionbackgroundcolor 170msdataslicetypesocialiconshover vevohoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinedataslicetypebuttons lisqsslidewrapperdataslidetypelockscreeniconwrapperwidth24pxheight24pxmargin0dataslicetypesocialiconshover twitchhoverbuttonstyleraisedinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlineeaseinouttransitionbackgroundcolordataslicetypesocialiconshover fivehundredpixdataslicetypesocialicons squarespace170ms easeinoutsqsslidewrapperdataslidetypelockscreendataslicetypegallery galleryvideobackground170ms easeinouttransitionbackgroundcolordataslicetypesocialiconsdataslicetypesocialiconshover vimeohoverdataslicetypesocialicons snapchatdataslicetypesocialiconshover tidaleaseinoutmoztransitionbackgroundcolorlightboxcontentdataslicetypebuttons li asqsslidewrapperdataslidetypelockscreensocialiconssizeextralargesocialiconsstyleborderusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons soundcloudlockstyleknockout dataslicetypelockshowtracktitle sqsalbumminimaldataslicetypesocialicons stumbleupondataslicetypesocialiconshover goodreadsdataslicetypebuttons lidataslicetypesocialiconshover stitcherdataslicetypesocialicons githubdataslicetypesocialicons codepenlightboxcontent formwrapper pbuttonstyleoutlinesqsmodallightboxresponsivewrapperstacked dataslicetypebuttons uldataslicetypesocialiconshover pinterestsnapchathoversocialiconscolorstandardsocialiconsstyleborderuseiconfill0976b4sqsslidewrapperdataslidetypelockscreenuseiconfill1ea9e1sqsslidewrapperdataslidetypelockscreenasqsslidewrapperdataslidetypelockscreen buttonstyleoutline sqsslicecustomformdataslicetypesocialiconshover codepenuseiconfillff0031sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesolidusemaskfill222sqsslidewrapperdataslidetypelockscreeneasesqsslidewrapperdataslidetypelockscreendataslicetypebuttonssvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveractionsnotstacked inputwrappernothiddendatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreeninputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutline datacompoundtypepopupoverlayactionuseiconfill1769ffsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineduseiconfillae995asqsslidewrapperdataslidetypelockscreen2emituneshoverdataslicetypegallerysqsgallerygriddataslicetypesocialicons thedotsyoutubelockstylesolidgalleryvideobackgroundmobileeaseinoutotransitioncolorarrowiconsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdataslicetypealbum sqsslicealbumplaylistdemoalbumsqssliceplaybuttoniconwrapperinputwrapperdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolidstumbleuponaudioplayericonsstyleregular dataslicetypealbumimdbcountdowncontentdataformattextual countdownunitsocialiconssizesmallsocialiconsstyleknockoutdataslicetypemap gmnoprinticonwrapperborder2pxvscohoverdataslicetypesocialiconshover spotifysqsslidewrapperdataslidetypelockscreen responsivewrappernotstackedsocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialicons flickrsqsmodallightboxcontentul liflickrdropbox0 0sqsslidewrapperdataslidetypelockscreensqsslidecontainernotautoimagebackgroundcolordataslicetypecountdownsqsmodallightboxcontent lightboxinner lightboxcontent2suseiconfill7dbb00sqsslidewrapperdataslidetypelockscreen2s easeinotransitionopacitybuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedli ahoversqsslidewrapperdataslidetypelockscreendataslicetypesocialicons smugmugrdiohoverliuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidsocialiconssizesmallsocialiconsstyleregularsoundclouddataslicetypesocialiconshover emailhovertracksbuttonstyleoutline sqsslicecustomformuseiconfill00b488sqsslidewrapperdataslidetypelockscreenresponsivewrappernotstackedsquarespacehoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddenasqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreen socialiconsstylesoliddataslicetypesocialicons googleplayusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreentwitterhoverdatacompoundtypepopupoverlayactiondataslicetypesocialicons emailuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypesocialiconshover dropboxhoverspotifyhoversocialiconsstyleborderactionsstacked inputwrappernothiddenyelpuseiconfill6441a5sqsslidewrapperdataslidetypelockscreenuseiconfill5adfcbsqsslidewrapperdataslidetypelockscreen14pxdataslicetypegallerysoliddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliddataslicetypesocialiconshover vineresponsivewrappersqsslicecustomform asqsslidewrapperdataslidetypelockscreeninstagraminputtypesubmithoversqsslidewrapperdataslidetypelockscreenautoflex1inputtypetextsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover redditeaseinoutmstransitionbackgroundcolor 170msdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypelockscreeniconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreenaudioplayericonsstylesoliddataslicetypealbumhover iconwrapperhoverstitchersocialiconsstylesolid dataslicetypesocialiconsbuttonshapepillsocialiconssizemediumsocialiconsstyleknockoutusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoveruseiconfill0099e5sqsslidewrapperdataslidetypelockscreeneaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolortidalall and maxwidth600pxsqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreenbuttonstyleoutlinesqsmodallightbox formwrappereaseinout bordercolor 170msdataslicetypesocialicons behancesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreenuseiconfille4405fsqsslidewrapperdataslidetypelockscreenuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover linkedinhoveradisplayblocksqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialicons redditusemaskfilltransparentsqsslidewrapperdataslidetypelockscreeninputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreengoogleplaydataslicetypesocialiconshover snapchathovertumblrhover170ms easeinoutotransitionbackgroundcolor 170ms2em 0px 0pxdataslicetypesocialiconshover pinteresthoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactiondataslicetypesocialiconshover iconwrapperfoursquarehoverusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout2s easeinmstransitionopacitystumbleuponhoversvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreendataslicetypebuttons ul01suseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenableddataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypelockscreenusebackgroundfillfffsqsslidewrapperdataslidetypelockscreentwitch0msformwrapper p170ms easeinoutmoztransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddeneaseoutopacity 170msuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularvinelightboxcontent formwrapperuseiconfillfffsqsslidewrapperdataslidetypelockscreenuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialiconshover yelpsqsslicealbumplaylist tracks tracksqsslicealbumplayliststackeddataslicetypesocialiconshover instagrammediumallsqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutdataslicetypesocialiconshover mediumhovergmstylecceaseinoutmoztransitioncolordataslicetypesocialiconshover stitcherhoverbuttonstylesolidresponsivewrapperstacked sqsslicecustomformasqsslidewrapperdataslidetypelockscreen dataslicetypetwittergmnoprint2s easeinmstransitionopacity 2sdataslicetypesocialiconshover snapchatdataslicetypebuttons ahoversqsslidewrapperdataslidetypelockscreenuseiconfill006ed2sqsslidewrapperdataslidetypelockscreenimportantsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover houzzsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline6pxresponsivewrapperstacked dataslicetypenavigationuseiconfill7ac143sqsslidewrapperdataslidetypelockscreendataslicetypecountdown countdowncontentdataformattextual countdownunitsocialiconsstyleknockouteaseinoutotransitionbackgroundcolor 170msuseiconfill000sqsslidewrapperdataslidetypelockscreenul li asqsslidewrapperdataslidetypelockscreenvideoiconstylebordercaptchacontainerwrapperdataslicetypetwitternotdatacompoundtype tweetbodyshowtracktitlesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypesocialiconshover linkedinsvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolordataslicetypesocialiconshover applepodcasthoveruseiconfill3b5998sqsslidewrapperdataslidetypelockscreensocialiconssizeextrasmallsocialiconsstyleregulardataslicetypesocialiconshover tidalhoverdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypelockscreenmeetuphoverdataslicetypesocialiconshover stumbleupondataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreencodepenhoverpdataslicetypesocialiconshover thedotshoverdataslicetypenavigation ul lidataslicetypesocialicons imdbpasswordstyleunderlineduseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialicons applepodcastulsqsslidewrapperdataslidetypelockscreenuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreenspotify2s easeinmoztransitionopacityeaseinmoztransitionopacity 2sdataslicetypetwitternotdatacompoundtype tweettimestampdataslicetypesocialiconshover smugmughovermapstyleminimaldarkdataslicetypesocialicons vscosqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodydataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypelockscreendataslicetypealbumhover iconwrappersqsslicealbumplaylistlockstyleregular dataslicetypelocksqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumbandsintownhoverdataslicetypesocialiconshover twittersocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactionasqsslidewrapperdataslidetypelockscreen buttonstyleoutline10sqsslidewrapperdataslidetypelockscreenaudioplayericonsstylesolid dataslicetypealbumhover170ms easeinoutmstransitionbackgroundcolordataslicetypesocialiconshover youtubehoverdataslicetypesocialicons itunessqsslidewrapperdataslidetypelockscreen dataslicetypecountdown countdowncontentdataformatnumericiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlineusebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactiontracks trackpasswordstylerectangle dataslicetypepassworddataslicetypetwitternotdatacompoundtypedataslicetypesocialiconshover twitcheaseinouttransitioncolordataslicetypesocialiconshover thedotshouzzhoverdataslicetypesocialiconshover githubhoverthedots170ms easeinoutotransitionbackgroundcolordropboxhoverimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainernotautoimagebackgroundcolordataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockout5emfont14pxeaseinmstransitionopacitysvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover googledataslicetypenavigationlinkedinhovermeetupsqsslicealbumplaylistplayingrdiodataslicetypesocialicons fivehundredpixerrormessagesqsslidewrapperdataslidetypelockscreenuseiconfille52d27sqsslidewrapperdataslidetypelockscreendataslicetypebuttons ul li170ms easeinoutmoztransitionbackgroundcolorsqsmodallightboxdataslicetypesocialiconshover tumblrapplepodcastrsshoveruseiconfillec4652sqsslidewrapperdataslidetypelockscreendataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreenbordercolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreendataslicetypelockuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypelockscreen2s easesqsslidewrapperdataslidetypelockscreenbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover vimeosocialiconsstylesolid dataslicetypesocialiconshover iconwrapperdataslicetypesocialiconshover mediumiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialicons meetupeaseinoutmstransitioncolorsocialiconssizelargesocialiconsstyleborderfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emsocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoversmugmuguseiconfill84bd00sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons googleinputtypesubmitsqsslidewrapperdataslidetypelockscreen2s 2sdataslicetypesocialiconshover tumblrhovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolidpasswordstyleunderlined dataslicetypepasswordtwitteruseiconfill00b4b3sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonsdataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreenbuttonshaperoundedcornerssqsslicecustomform spansqsslidewrapperdataslidetypelockscreeniconwrapperwidth36pxheight36pxmargin0dataslicetypealbum sqsslicealbumplaylistplayingdataslicetypebuttons ulstackedonly screensqsslicecustomformsqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover emailtrackprogressbardataslicetypesocialiconshover fivehundredpixhoveruseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutvideoiconstyleknockoutdataslicetypesocialicons pinteresttidalhovereaseinotransitionopacityiconwrapperdataslicetypesocialiconshover houzzhoverdataslicetypesocialiconshover facebookhoversqsslidecontainerdataslidetypepopupoverlaydataslicetypesocialiconshover githubsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover behancedataslicetypesocialiconshoverdataslicetypesocialiconshover smugmugdisplaytablesqsslidewrapperdataslidetypelockscreensocialiconsstyleborder dataslicetypesocialiconsresponsivewrapperstacked dataslicetypenavigation ulfacebookhoverdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreenvevohoverdataslicetypebuttonssqsslidewrapperdataslidetypelockscreeneaseinoutmoztransitionbackgroundcolor 170mslightboxinner lightboxcontent formwrappersqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypelockscreenuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshovershowtracktitle sqsalbumminimal dataslicetypealbumbehancehoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons lisqsslicecustomformvscopinteresthoverformwrappersqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsdataslicetypesocialiconshover flickrdataslicetypesocialicons dribbbleusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfill0063dcsqsslidewrapperdataslidetypelockscreengooglesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautoitunesuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshover0pxavisitedsqsslidewrapperdataslidetypelockscreensocialiconssizemediumsocialiconsstyleregularsocialiconssizemediumsocialiconsstyleborder1pxsvgsocialwebkittransitionbackgroundcolor 170mssocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsfoursquareeaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypealbumhoverbehancesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverfffsqsslidewrapperdataslidetypelockscreensqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeddataslicetypebuttons asqsslidewrapperdataslidetypelockscreenlockstyleknockoutsqsslicealbumplaylist tracksdataslicetypesocialiconshover meetuphoverlockstylesolid dataslicetypelockdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover rsshoverdataslicetypesocialicons instagramdataslicetypesocialiconshover yelphoversvgsocialwebkittransitionbackgroundcolor10pxiconwrappersqsslidewrapperdataslidetypelockscreenuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularcountdowncontentdataformatnumericformitemsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons bandsintownyelphoversocialiconsstyleregulardataslicetypesocialiconshover vscoeaseinouttransitionbackgroundcolor 170msdataslicetypesocialiconshover itunesiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutsqsslidewrapperdataslidetypelockscreen dataslicetypecountdowndataslicetypealbum tracktitleuseiconfilldc4e41sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons houzztrackiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesolidsqsslidewrapperdataslidetypelockscreendataslicetypemap gmstylecciconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesoliddataslicetypesocialicons rssdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockouteaseoutopacitydataslicetypesocialiconshover iconwrapperhoverlinkedindataslicetypesocialiconshover googleplaysqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionsocialiconsstyleregular dataslicetypesocialiconsgoodreadsdataslicetypesocialicons vimeouseiconfill382110sqsslidewrapperdataslidetypelockscreenvideoiconstylesolidsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonssocialiconssizeextralargesocialiconsstylesolid170ms easeinoutmstransitionbackgroundcolor 170msdataslicetypesocialicons mediumsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackedsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinedribbbleiconwrapperwidth28pxheight28pxmargin0170ms easeoutopacitygooglehovereaseinmoztransitionopacitytumblrdataslicetypesocialiconshover imdbdataslicetypesocialicons foursquare2em 0pxsquarespacecountdowncontentdataformattextualsqsslidelayercontentsocialstacked0ms 0msdataslicetypesocialiconshover vscohoverdataslicetypesocialiconshover facebookdataslicetypecountdown countdowncontentdataformattextualdataslicetypesocialiconshover squarespacehoversocialiconssizesmallsocialiconsstyleborderimdbhoveruseiconfill007ee5sqsslidewrapperdataslidetypelockscreeneaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreendatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypelockscreeninputtypepasswordsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons yelpinputtypetextsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover meetupsmugmughoveraudioplayericonsstyleregularapplepodcasthoverdataslicetypesocialiconshover goodreadshoversqssliceplaybuttoniconwrapperhovergithub170ms easeinoutbuttontypesubmitsqsslidewrapperdataslidetypelockscreen100msmediumhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover youtubeusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypegallery galleryvideobackgroundmobilevimeohoveruseiconfillf60sqsslidewrapperdataslidetypelockscreentracktitleiconwrapperlastchildsqsslidewrapperdataslidetypelockscreendataslicetypebodydataslicetypesocialiconshover dropboxtweetdisplaynamedataslicetypesocialiconshover behancehovertwitchhoverdataslicetypeheadingnotdatacompoundtypetweethandleaudioplayericonsstyleborder dataslicetypealbumdataslicetypesocialicons twitchuldataslicetypesocialiconshover imdbhovereaseinout bordercoloraudioplayericonsstyleborderdisclaimercontainersqsslidewrapperdataslidetypelockscreendataslicetypealbumactionsstacked inputwrapperdataslicetypesocialiconshover rdiosqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterdataslicetypesocialicons tidaldataslicetypealbum iconwrappersqsslidewrapperdataslidetypelockscreensocialiconsstylesolidfivehundredpixdataslicetypepassword arrowiconscreensvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid8pxsocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreenlockstyleborderdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialiconshover reddithoverdataslicetypecountdown countdowncontentdataformatnumericcodepenautosqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover dribbblehoverdataslicetypesocialiconshover foursquaresocialiconssizesmallsocialiconsstylesoliduseiconfill222sqsslidewrapperdataslidetypelockscreen7px

Longtail Keyword Density for Thestew.us

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
ease-in-out border-color 170ms15
170ms ease-in-out border-color15
lightbox-inner lightbox-content form-wrapper14
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
2em 0px 0px6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typelock-screen5
data-slice-typenavigation ul li5
170ms ease-outopacity 170ms5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typelock-screen4
data-slice-typebuttons ul li4
lightbox-content form-wrapper p4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
responsive-wrapperstacked data-slice-typenavigation ul4
responsive-wrapperstacked data-slice-typebuttons ul3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline data-compound-typepopup-overlay-action3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
screen and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
ul li asqs-slide-wrapperdata-slide-typelock-screen3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
all and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
border-color 170ms15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen13
data-slice-typebuttons ul12
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typelock-screen11
data-slice-typebuttons li10
password-style-underlined data-slice-typepassword10
data-slice-typenavigation ul10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
ul li9
password-style-rectangle data-slice-typepassword9
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typelock-screen8
li asqs-slide-wrapperdata-slide-typelock-screen8
170ms ease-in-out-moz-transitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typelock-screen7
social-icons-style-border data-slice-typesocial-icons7
show-track-title sqs-album-minimal7
tracks track7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
button-style-outline sqs-slice-custom-form6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typelock-screen6
data-slice-typesocial-iconshover icon-wrapperhover6
2em 0px6
data-slice-typealbum track-progress-bar6
audio-player-icons-style-border data-slice-typealbum6
0px 0px6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
button-style-outline data-slice-typebuttons6
ease-outopacity 170ms5
data-slice-typesocial-icons dropbox5
170ms ease-outopacity5
data-slice-typesocial-icons twitch5
ul lisqs-slide-wrapperdata-slide-typelock-screen5
responsive-wrapperstacked data-slice-typenavigation5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons dribbble5
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons codepen5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons github5
data-slice-typesocial-icons google5
responsive-wrapperstacked data-slice-typebuttons5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons email5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons youtube5
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typebuttons5
data-slice-typesocial-iconshover icon-wrapper5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons vsco5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons rdio5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons linkedin5
0ms 0ms5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons vevo5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons bandsintown5
2s 2s5
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover squarespace4
form-wrapper p4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover rdio4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover facebook4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
lock-style-border data-slice-typelock4
actionsnotstacked input-wrappernothidden4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typelock-screen4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
svgsocial-webkit-transitionbackground-color 170ms4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typelock-screen4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
li ahoversqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
social-icons-style-knockout data-slice-typesocial-icons3
actionsstacked input-wrapper3
social-icons-style-solid data-slice-typesocial-icons3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typelock-screen3
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
form-itemsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typelock-screen3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
lock-style-solid data-slice-typelock3
sqs-slide-wrapperdata-slide-typelock-screen responsive-wrappernotstacked3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typelock-screen3
audio-player-icons-style-regular data-slice-typealbum3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttons ulstacked3
data-slice-typemap gmnoprint3
data-slice-typemap gm-style-cc3
only screen3
data-slice-typealbum sqs-slice-album-playliststacked3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum track-title3
data-slice-typegallery gallery-video-backgroundmobile3
data-slice-typetwitter tweet-avatar3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containernotauto-image-background-color3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
asqs-slide-wrapperdata-slide-typelock-screen data-slice-typetwitter3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
countdown-contentdata-formattextual countdown-unit3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown3
p ahoversqs-slide-wrapperdata-slide-typelock-screen3
p asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
2s easesqs-slide-wrapperdata-slide-typelock-screen3
actionsstacked input-wrappernothidden3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen140
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-compound-typepopup-overlay-action60
data-slice-typebuttons59
sqs-slide-containerdata-slide-typepopup-overlay54
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen44
2s41
asqs-slide-wrapperdata-slide-typelock-screen38
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typelock-screen34
data-slice-typegallery33
data-slice-typelock30
data-slice-typepassword29
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
form-wrapper28
sqs-album-minimal27
1s25
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen24
sqs-modal-lightbox-content24
sqs-slice-custom-form24
0sqs-slide-wrapperdata-slide-typelock-screen24
icon-wrapper23
lightbox-inner22
ul22
responsive-wrapperstacked21
socialstackedtext-align-left20
sqs-slide-wrapperdata-slide-typelock-screen20
socialstacked20
li20
020
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
data-slice-typenavigation17
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen17
tracks16
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
border-color15
data-slice-typebody15
gallery-video-background14
ahoversqs-slide-wrapperdata-slide-typelock-screen13
sqs-modal-lightbox-open13
p13
social-icons-style-solid12
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen12
0px12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen12
actionsnotstacked12
icon-wrapperhover12
password-style-rectangle11
password-style-underlined11
data-slice-typetwitter11
countdown-contentdata-formattextual11
actionsstacked11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
squarespace10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
lisqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typetwitternotdata-compound-type10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
110
solid10
0ms10
vimeo9
thedots9
tidal9
tumblr9
twitch9
twitter9
vevo9
rdio9
codepen9
behance9
bandsintown9
stumbleupon9
vsco9
yelp9
youtube9
applepodcast9
vine9
soundcloud9
stitcher9
googleplay9
meetup9
reddit9
medium9
linkedin9
itunes9
instagram9
imdb9
houzz9
google9
goodreads9
pinterest9
rss9
github9
smugmug9
flickr9
fivehundredpix9
facebook9
email9
snapchat9
dropbox9
dribbble9
spotify9
foursquare9
ease-in-out-ms-transitionbackground-color9
ease-in-outtransitionbackground-color9
ease-in-out-moz-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
max-width600pxsqs-slide-wrapperdata-slide-typelock-screen8
sqs-slice-play-buttonicon-wrapper8
all8
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
show-track-title7
spansqs-slide-wrapperdata-slide-typelock-screen7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typelock-screen7
video-icon-style-border7
track7
social-icons-style-border7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen7
button-style-outlinesqs-modal-lightbox7
input-wrappernothidden7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen7
data-slice-typemap7
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
2em6
audio-player-icons-style-border6
button-style-raised6
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
10px6
audio-player-icons-style-solid6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
sqs-slice-play-buttonicon-wrapperhover6
input-wrapper6
ulsqs-slide-wrapperdata-slide-typelock-screen6
social-icons-style-regular6
track-progress-bar6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
vevohover5
houzzhover5
soundcloudhover5
reddithover5
googlehover5
vimeohover5
googleplayhover5
rsshover5
vinehover5
6px5
goodreadshover5
svgsocial-webkit-transitionbackground-color5
sqs-slice-album-playlistplaying5
imdbhover5
stitcherhover5
mediumhover5
meetuphover5
stumbleuponhover5
linkedinhover5
tidalhover5
ituneshover5
pinteresthover5
twitterhover5
tumblrhover5
spotifyhover5
rdiohover5
twitchhover5
instagramhover5
thedotshover5
audio-player-icons-style-regular5
squarespacehover5
githubhover5
dribbblehover5
01s5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
buttonsqs-slide-wrapperdata-slide-typelock-screen5
sqs-slide-layer-content5
lock-style-regular5
applepodcasthover5
tweet-timestamp5
bandsintownhover5
social-icons-style-knockout5
vscohover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen5
codepenhover5
button-shape-pill5
behancehover5
button-shape-rounded-corners5
gmnoprint5
foursquarehover5
gm-style-cc5
flickrhover5
yelphover5
fivehundredpixhover5
youtubehover5
facebookhover5
smugmughover5
dropboxhover5
100ms5
emailhover5
ease-outopacity5
snapchathover5
tweet-body4
lock-style-border4
icon-wrapperwidth24pxheight24pxmargin04
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typelock-screen4
displaytablesqs-slide-wrapperdata-slide-typelock-screen4
form-itemsqs-slide-wrapperdata-slide-typelock-screen4
video-icon-style-solid4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
5px4
audio-player-icons-style-knockout4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typelock-screen4
4px4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
video-icon-style-regular4
ulstacked4
map-style-minimal-dark4
track-title4
icon-wrapperwidth36pxheight36pxmargin03
use-iconfill000sqs-slide-wrapperdata-slide-typelock-screen3
inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
easesqs-slide-wrapperdata-slide-typelock-screen3
arrow-icon3
14px3
autoflex13
video-icon-style-knockout3
avisitedsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-smallsocial-icons-style-regular3
icon-wrapperborder2px3
lock-style-knockout3
fffsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typelock-screen3
tweet-handle3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typelock-screen3
lock-style-solid3
tweet-display-name3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typelock-screen3
tweet-avatar3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
autosqs-slide-wrapperdata-slide-typelock-screen3
sqs-modal-lightbox3
buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typelock-screen3
button-style-solid3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-largesocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
error-messagesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-regular3
responsive-wrapper3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typelock-screen3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
sqs-slidesqs-slide-animation-ready3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
responsive-wrapperstackedtext-align-center3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-border3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
social-icons-size-largesocial-icons-style-knockout3
responsive-wrappernotstacked3
social-icons-size-largesocial-icons-style-solid3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
social-icons-size-extra-largesocial-icons-style-border3
adisplayblocksqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
ease-in-outtransitioncolor3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
use-iconfille0393esqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillff0031sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille6b91esqs-slide-wrapperdata-slide-typelock-screen3
only3
use-iconfill55aceesqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille4405fsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playliststacked3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillec4652sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill35465dsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playlistdemo-album3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typelock-screen3
3px3
button-play-pause3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfillcc2127sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-regular3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth32pxheight32pxmargin03
use-iconfillff4500sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf60sqs-slide-wrapperdata-slide-typelock-screen3
7px3
screen3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typeheadingnotdata-compound-type3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typelock-screen3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
countdown-unit3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typegallerysqs-gallery-grid3
sqs-slide-containernotauto-image-background-color3
disclaimer-containersqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typelock-screen3
1px3
ease-in-moz-transitionopacity3
neuearialsans-seriffont-size14pxline-height13emtext-transformnoneletter-spacing05emfont-weightnormalfont-stylenormalcolor3a3a3asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-ms-transitionopacity3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typelock-screen3
ease-in-o-transitionopacity3
ease-intransitionopacity3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille52d27sqs-slide-wrapperdata-slide-typelock-screen3
gallery-video-backgroundmobile3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillc41200sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf94877sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillae995asqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill382110sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00b488sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-smallsocial-icons-style-regular3

Who hosts Thestew.us?

Thestew.us Hosting Provider Information

Hosted IP Address:198.49.23.145
Hosted Hostname:198.49.23.145
Service Provider:SQUARESPACE
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Squarespace

Is "SQUARESPACE" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
SQUARESPACE
1.4390%

HTTP Header Analysis for Thestew.us

Http-Version: 1.1
Status-Code: 401
Status: 401 Unauthorized
Age: 0
Content-Type: text/html;charset=utf-8
Date: Mon, 10 May 2021 02:06:12 GMT
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Server: Squarespace
Strict-Transport-Security: max-age=0
X-Content-Type-Options: nosniff
X-Contextid: HPDpSGjh/rAZTWPC9
Transfer-Encoding: chunked

Thestew.us Domain Nameserver Information

HostIP AddressCountry
ns-cloud-e2.googledomains.com 216.239.34.110
ns-cloud-e3.googledomains.com 216.239.36.110
ns-cloud-e1.googledomains.com 216.239.32.110
ns-cloud-e4.googledomains.com 216.239.38.110


Need to find out who hosts Thestew.us?


Domain Registration (WhoIs) information for Thestew.us

 Domain Name: thestew.us
Registry Domain ID: D35525D612DE24D0590BB4FCA537B32D8-NSR
Registrar WHOIS Server: whois.google.com
Registrar URL: https://domains.google
Updated Date: 2020-06-15T14:25:51Z
Creation Date: 2020-06-10T14:25:45Z
Registry Expiry Date: 2021-06-10T14:25:45Z
Registrar: Google LLC
Registrar IANA ID: 895
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6502530000
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C6E0396227ACE4920B7E70A541D4D68FC-NSR
Registrant Name: Maurice D Wilkins
Registrant Organization:
Registrant Street: 2348 E. 19th Street
Registrant Street:
Registrant Street:
Registrant City: Oakland
Registrant State/Province: CA
Registrant Postal Code: 94601
Registrant Country: US
Registrant Phone: +1.2026412747
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Application Purpose: P3
Registrant Nexus Category: C11
Registry Admin ID: C6E0396227ACE4920B7E70A541D4D68FC-NSR
Admin Name: Maurice D Wilkins
Admin Organization:
Admin Street: 2348 E. 19th Street
Admin Street:
Admin Street:
Admin City: Oakland
Admin State/Province: CA
Admin Postal Code: 94601
Admin Country: US
Admin Phone: +1.2026412747
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Application Purpose: P3
Admin Nexus Category: C11
Registry Tech ID: C6E0396227ACE4920B7E70A541D4D68FC-NSR
Tech Name: Maurice D Wilkins
Tech Organization:
Tech Street: 2348 E. 19th Street
Tech Street:
Tech Street:
Tech City: Oakland
Tech State/Province: CA
Tech Postal Code: 94601
Tech Country: US
Tech Phone: +1.2026412747
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Application Purpose: P3
Tech Nexus Category: C11
Name Server: ns-cloud-e2.googledomains.com
Name Server: ns-cloud-e3.googledomains.com
Name Server: ns-cloud-e1.googledomains.com
Name Server: ns-cloud-e4.googledomains.com
DNSSEC: signedDelegation
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-05-10T02:06:13Z

Recently Updated Websites

Mcortelecom.com (1 second ago.)Camovingpartners.com (4 seconds ago.)Jubilee.center (4 seconds ago.)Sportsundspa.com (6 seconds ago.)Qpvip888.vip (6 seconds ago.)Johnpittscpa.com (8 seconds ago.)Tampabaybeachmoves.com (9 seconds ago.)Memories-sub.blogspot.com (9 seconds ago.)Goessling-hospitalplanung.com (10 seconds ago.)Alanbourne.com (11 seconds ago.)Louis-bacon.net (12 seconds ago.)Go-in-vietnam-visas-ok.live (13 seconds ago.)Giftacoffee.org (13 seconds ago.)Samratsteels.com (15 seconds ago.)Tw2hnv.com (15 seconds ago.)Khazanah.com (17 seconds ago.)Ameliadriver.com (18 seconds ago.)Old.show (18 seconds ago.)Alyssabrandtcreative.com (18 seconds ago.)Dreamtimepr.com (19 seconds ago.)Ecpd.ie (20 seconds ago.)Chillicothehighschool.net (20 seconds ago.)Mcdougallmusic.com (22 seconds ago.)Inventmj.com (23 seconds ago.)Scfysey.com (23 seconds ago.)Codybateman.org (23 seconds ago.)Graphicyard.com (24 seconds ago.)Rdkengineers.com (24 seconds ago.)Coloradocustoms.com (25 seconds ago.)Truegreece.com (25 seconds ago.)

Recently Searched Keywords

frequently asked questions pdf (1 second ago.)ffb-title-2 afterffb-id-hdf4e5d ffb-title-2 (2 seconds ago.)24 carat gold price in usa today 1 ounce (5 seconds ago.)75a (6 seconds ago.)group common jsname (8 seconds ago.)facebook.com (8 seconds ago.)telecom review lance une série de panels virtuels (9 seconds ago.)爆操母狗 (9 seconds ago.)border-bottom-style solid (9 seconds ago.)telefoonhouder bureau mediamarkt (10 seconds ago.)next arrows (10 seconds ago.)6:15 goth stepsiblings played rough sex all night (10 seconds ago.)filter refills (11 seconds ago.)tribalwars.com.pt (11 seconds ago.)fz 4007 (12 seconds ago.)andrzej sołdra (13 seconds ago.)lol外围黄桥镇卫生院联合县血站开展无偿献血活动 (14 seconds ago.)wye niemiecki (14 seconds ago.)23662368 2370 (15 seconds ago.)anime skins (16 seconds ago.)7.sınıf sosyal bilgiler ders kitabı cevapları meb ekoyay (16 seconds ago.)january 9 2019 (16 seconds ago.)zjglvshi (18 seconds ago.)济南大学 (20 seconds ago.)100х100 (20 seconds ago.)may not have (22 seconds ago.)クルマ好き読者の想いが詰まった愛車ファイル! (23 seconds ago.)казань (24 seconds ago.)pantum p2509w (24 seconds ago.)1030- (26 seconds ago.)