Thesun.co.uk  |  Access Denied
High trust score  | 

Thesun.co.uk Website Information

Thesun.co.uk has a High trust score, a Statvoo Rank of A, an Alexa Rank of 1,092, a Majestic Rank of 513, a Domain Authority of 88% and is listed in DMOZ.

Thesun.co.uk is hosted by NEWS CORP UK & IRELAND LIMITED in United Kingdom.
Thesun.co.uk has an IP Address of 143.252.148.217 and a hostname of redirects.vip.newsint.co.uk and runs Apache-Coyote/1.1 web server.

The domain thesun.co.uk was registered 2 decades 2 years 4 months ago by , it was last modified 5 years 1 month 3 weeks ago and currently is set to expire 201 decades 9 years 2 days ago.


Whois information for thesun.co.uk

Full Whois Lookup for Thesun.co.uk Whois Lookup

Domain name:
thesun.co.uk

Registrant:
News Group Newspapers Limited

Registrant type:
Unknown

Registrant's address:
1 London Bridge Street
London
SE1 9GF
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 25-Jul-2014

Registrar:
Markmonitor Inc. t/a MarkMonitor Inc. [Tag = MARKMONITOR]
URL: http://www.markmonitor.com

Relevant dates:
Registered on: 19-May-1997
Expiry date: 19-May-2018
Last updated: 06-Mar-2017

Registration status:
Registered until expiry date.

Name servers:
ns1-143.akam.net
ns1-217.akam.net
use1.akam.net
use2.akam.net
use4.akam.net
use5.akam.net
usw2.akam.net

WHOIS lookup made at 16:47:25 03-Sep-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Thesun.co.uk?

Thesun.co.uk Web Server Information

Hosted IP Address:143.252.148.217
Hosted Hostname:redirects.vip.newsint.co.uk
Service Provider:NEWS CORP UK & IRELAND LIMITED
Hosted Country:United KingdomGB
Location Latitude:51.5
Location Longitude:-0.13
Webserver Software:Apache-Coyote/1.1

HTTP Header Analysis for Thesun.co.uk

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Server: AkamaiGHost
Mime-Version: 1.0
Content-Type: text/html
Content-Length: 270
Expires: Fri, 22 May 2015 13:20:02 GMT
Date: Fri, 22 May 2015 13:20:02 GMT
Connection: close


Need to find out who hosts Thesun.co.uk?

Thesun.co.uk Free SEO Report

Website Inpage Analysis for Thesun.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Thesun.co.uk

truth comesalongtheir wealthcopsholly willoughbydisplayad windowthesunadcmdlifegas explosionrulesgoodfamilyturningfitstillaugusttumblecallssleeveseventdrinkvarsessionsun saverssendhere039sstreet storeowners claimedamazingneutral top hightermsback to schoolshe039shasthirdperfecttakeclaimed it nevermakesdad039steamscrapsbradley lowerywetestscottishcomesnever goingyour kidsfunction function displayadrecipeslookspricesunsilvergroup newspapersmatchonlinecancerdiedcarpcbehindfoil039girls039 kids039eastendersdearemerge on facebookshepizzadreamkids of snapchatflauntoffboris johnsonvowdead3secrethorrorcarelovego intoultrabeautyneedsstarts fightwifegirlfuriousabovebritainthesunadcmd thesunadcmdyou trydecaderightbutholidayhomesmoviesdamningparkfoundanytravellatest bonkers beautyastronautnuclear testuseendweeklabourscottish sunshowbizafter leavingdream teambets sunfox coveringmeholidayshousesbrexit cashprimark is sellingvar thesunadcmdmay039sclaimstouristescapeexplosive storyline eastendersbank holiday weekendprevious ownerscan nowwantingwatchthomasnuclearafterdietgoogletagdisplayyour phonedressesrangegettinginsidehousefriendsgoing bonkersvolkswagenfunction varrelationshipfabulous latesteven makesthesunadcmdpushkatie pricestreetsleeves downmay havelittle girl5leavingplanparentsgivebombtonyadmitsbought 750k homesupportanticsroyaltellgroupfacehugebreakthingsharrysweettin foilkeycroniestorytheresa maywars fansenglandkieran haylerslamsovernorth koreanchocolatesnapset the biggestjuststorylinetv amp showbizyour kneesmentalmoneyphonesportssix years afterbonkersmediastreet store scrapsprimarkhavingseeherslammedeastenders is setnew yorkputstartfoil likecountrykorean nuclearcharity football matchnoawaydinghy starts fightdaysmoney back afterspanishasleep in dinghytourist who fellfearedproblems039tojamieperformshoppingnighthadgrenfellbreaks outlocalcomplaintsrevealmaysnapchatflaunt theirpaynethroneswindowthesunadcmd windowthesunadcmdpush functiongame4grenfell charityneed to know750ksingerfunction googletagdisplaydesertpoliticsthankscannorth korean nuclearyearprimebringwhysun saystonguerewards clubkids039 clothesfunction displayad windowthesunadcmdhas ever builtboozehealthever builtlowerybrawl breaks outshouldbiggest the companyamericantheir money backleftticketwinfootballpoliceopening hourschildnews revealedsnapchatflauntdowneightname1gangkingstrikestar wars fansbuiltindustrymake youirish sunneverlego settips0043but there039swindowthesunadcmdpush function googletagdisplaychewbrickerour rewards clubcoleen rooneyopens upblockingshowsthrowingbossprettyeverybritain039ssixdenim jacketshownever floods demandhas everadamclothesfootstepsthesunadcmd thesunadcmd thesunadcmdpushraiseeulaunchedtakensyndicationpartypmfunctionafter previoussilentsetlittlenicolebut wouldlooknetaporter is sellingeven makes floralsolutions to veryclubheasleepfantasy football tipsseptemberhitdeathcoleenwayne rooneyshareswindowthesunadcmd windowthesunadcmd windowthesunadcmdpushnetaporterhusbandreasongame of thronesshelling outbidcherylbigterms and conditionstransferstrulyscrapkeepgetopensjoseunisexafter theywaythan anyfanultimateyou needlatestbradleymusicweddinghas beenincrediblebrawlpreviousdiagnosedabusemakes floralbacknew lego setstoryline eastenderscomeromanticcontactsomebeachthereampkids039haylerferryeyeplansthesunadcmdpush function googletagdisplay7salethanthroughweekenddemand their moneyinsistsmonthshigh streethitsgame4grenfell charity footballservicesheadhollyfirsttechevilfloodscouple who boughtarriveshorrifiedexclusivemumafter twosaturdaythesunadcmd thesunadcmdpush functioncardtwotrend but039girls039toldblastmissingnextraedamning pictures emergefrenchapplewindowthesunadcmd windowthesunadcmdpushclosewomenpricey problemsbeenpriceybattlehilariousastronaut peggythreerowpreparesun sunkieranbreakssleeve it outcoveringfans are goingpolltvfell asleepamazing new legokoreanstarswildtheselike a takeawayvideobuyamp showbiz latestexactlydieselimpractical denim jacketbiggestdavisit039spc bidneighboursfox covering eyebrowsexpectingafter heifhomenews commentpuncheshanddate2roadcomes flooding outthere039sdressaroundmovinggeordiefunction var thesunadcmdstore scrapsrestcan039tchewbricker star wars039girls039 kids039 clothesstonebritishtripnewssilver fox coveringamazing newelectionpopulargenderjolieoutdoorhappyalwaysplus getbreastworstseasontheirpoststarwin a copynews latestyoungtakeawaysaytop highgetstakingfindtv ampcharityparisnewspapersveniceever with sleevescashkilledfilmmadescraps 039boys039believecheatingpremierour rewardswayneholdsonebingotrend but woulddisplayad windowthesunadcmd windowthesunadcmdleadnew legoherewindowthesunadcmdfactorbonkers beauty trendhome afteremergemanywindowthesunadcmd windowthesunadcmd108foodpercopyevertonhelpusingtopfloods demandgas explosion butlinkvery pricey problemssnapchatflaunt their wealthroommost impractical denimwindowthesunadcmdpush functiontogetherevencan watchvisitcharity footballdavid beckhammoney backdecisionshows off039ilatest bonkersstateget a freetrenddinghy startsourislandfabulousbestmustwaitsexdemandsunshinenorthwealth with theseaskingconditionsclothes and evendriverbetterneedfailsguidesiteallpropertydenim jacket ever4amp showbizsleeveconfessescontact usdadplanetfootball tipskneesfoxmarriedarrestedopeningtheir moneyfantasyselling the mostschemewrongbonkers beautyafter damningdavid davis750k hometop high streetwholefiredocumentaddeventlistenerdomcontentloaded functiondieout coupleaxedbritsshowbiz latestbeinguk039sbabymakes floral dressesrooneywestdown to yourshow tv amplastyorkdinghyfloralanyonewantsspoilermust notduringdoesn039temotionalreturnrocktriesstaffyou can watchx factor039sgamecouldaccusedfansgoingsignsummerrockedwhichpauldealsdivorcetimemistakesplacerich kidsfabulous exclusivemay039s vowdavidhotelbank holidaypeoplehistorycompany hasx factortruthtrumpexpensivewindowthesunadcmdpushweightimpracticaldonald trumpflatfloral dresses unisexhisthronewatchingyears afternannydear deidredowhileherselfnews exclusiveitemsnever floodsxukweremyexplosivestar warsamp showbiz competitionmeetshe doesn039ttrevorkoreascrappage schemejoinscouplewantappyfriendworth9most impracticalcominggofloral dressestryafter previous ownersdocumentaddeventlistenerdomcontentloadedsleepaheadotherrecordbreakingfactor039sfightingfootball matchtaxmomentreturningblanket039boys039 and 039girls039johnsonnothingleaguesonenjoyhotofferback afterbodydresses unisexownersboughtbrexit039theypictures emergewebsitegirlfriendbradyevermorningfreeneutralexplosionyou canupholdfridgedaddyastronaut peggy whitsonitsfortunewould younewback after damningdenimusedbargainmodelcompany has evershowbiz competitionfamilieswhitecommenteasyonlyvideosstoreuntilhome after previousheartbrokengangsrewardsunitedstoryspaceprivatecorbyngame4grenfellexplosion butgrenfell charity footballbikiniholesdocumentaddeventlistenerdomcontentloaded function varflightbeforevery priceythousandsshellingkasaeimeganknowbeckhamcoolorderjacket everdemand theircompetitionsix yearsconditionexkidskatethesunadcmdpush functiongoing backtheresatinyintomuchfacebookmostpremier leagueoutworktimesfourqueenbets sun bingoeastexplosive storylineantics rich kidsclaimedpregnantsun betsfivehighleastchewbricker starhourmurstryingcostsgoalssavinghoursgender neutralfestivalblackcovering eyebrowsbeauty trend buttaylorsun bets sunlikewarningsun bingogoalwhitsoncompanytruth comes floodingthesunadcmd thesunadcmdpushirishhaveborissilver foxkorean nuclear testmakeholiday weekendanotherhusband kieran haylertributecomes floodingbetsnowfitnesscatchsoyetyourbecomerevealskidthese expensivefutureablejobabiesthese expensive solutionsincludingunisex in pcyearsdisplayadearthsaysgrenfell charityskintenerifeflooding outbrawl breakswouldlondontheresgotbankflooding out couplelinefloods demand theirman039boys039revealedprincessschooldon039tsaidexpensive solutionsannounceshimfellpeggyfantasy footballsunday0husband kierantinfunction displayadspottedlegomovefloodingpasteyebrowsjamie eastverybought 750klivebakesinceformerfundeidrehigh street storesolutionskatieisn039tbeauty trendsaversbecamesellingtearsshorehumanusflytenlostjacketmorebrexitactionplaneaugust bank holidaychristmasmental healthtin foil likereadbecausestunningafter damning picturesgaspicturesthing750k home afterdogeyebrows in tinparentingeidwoodburnbirthdayfunction functionscrappagewealthshow tvdayimpractical denimlovingmore thanpayprevious owners claimedout netaporterrichnakedpraised6favouriteworldfatbravejudgesdealtexassickwilloughbyplusfightshockinggardenvar thesunadcmd thesunadcmddelayantics richmassivethemsecondplanningnorth koreawarschangestartsbrainstopfollowfirst timevictoriabut would youprovesyouthesunadcmdwould you trymotorsnotwomanaugust bankdamning picturesdonaldsportneutral toppeggy whitsonstore scraps 039boys039year039scampgender neutral top

Longtail Keyword Density for Thesun.co.uk

KeywordsOccurences
tv amp showbiz52
fantasy football tips8
charity football match8
amp showbiz latest6
back to school5
august bank holiday5
husband kieran hayler5
primark is selling5
fans are going4
function var thesunadcmd4
win a copy4
var thesunadcmd thesunadcmd4
thesunadcmdpush function googletagdisplay4
thesunadcmd thesunadcmdpush function4
documentaddeventlistenerdomcontentloaded function var4
thesunadcmd thesunadcmd thesunadcmdpush4
astronaut peggy whitson4
star wars fans3
chewbricker star wars3
our rewards club3
claimed it never3
previous owners claimed3
biggest the company3
set the biggest3
new lego set3
amazing new lego3
get a free3
emerge on facebook3
demand their money3
company has ever3
their money back3
floods demand their3
money back after3
after damning pictures3
back after damning3
never floods demand3
damning pictures emerge3
store scraps 039boys0393
game4grenfell charity football3
korean nuclear test3
north korean nuclear3
unisex in pc3
brawl breaks out3
you can watch3
grenfell charity football3
amp showbiz competition3
need to know3
bank holiday weekend3
floral dresses unisex3
makes floral dresses3
high street store3
top high street3
neutral top high3
gender neutral top3
street store scraps3
after previous owners3
even makes floral3
clothes and even3
039girls039 kids039 clothes3
039boys039 and 039girls0393
has ever built3
truth comes flooding3
impractical denim jacket3
denim jacket ever3
most impractical denim3
selling the most3
net-a-porter is selling3
ever with sleeves3
down to your3
antics rich kids3
dinghy starts fight3
asleep in dinghy3
tourist who fell3
sleeve it out3
windowthesunadcmdpush function googletagdisplay3
eastenders is set3
gas explosion but3
explosive storyline eastenders3
terms and conditions3
bets sun bingo3
game of thrones3
function function displayad3
windowthesunadcmd windowthesunadcmdpush function3
windowthesunadcmd windowthesunadcmd windowthesunadcmdpush3
displayad windowthesunadcmd windowthesunadcmd3
function displayad windowthesunadcmd3
kids of snapchatflaunt3
snapchatflaunt their wealth3
six years after3
show tv amp3
would you try3
but would you3
trend but would3
sun bets sun3
comes flooding out3
750k home after3
bought 750k home3
couple who bought3
flooding out couple3
beauty trend but3
bonkers beauty trend3
very pricey problems3
solutions to very3
these expensive solutions3
wealth with these3
silver fox covering3
fox covering eyebrows3
latest bonkers beauty3
like a takeaway3
tin foil like3
eyebrows in tin3
home after previous3
tv amp52
amp showbiz52
fantasy football12
football match10
news latest10
function googletagdisplay9
wayne rooney9
news exclusive9
football tips8
katie price8
charity football8
you can7
bank holiday7
x factor7
theresa may6
documentaddeventlistenerdomcontentloaded function6
showbiz latest6
years after5
north korean5
husband kieran5
kieran hayler5
sun says5
august bank5
opening hours5
dream team5
grenfell charity5
home after5
make you5
fabulous latest5
you need5
scrappage scheme4
your kids4
can now4
show tv4
jamie east4
your phone4
x factor039s4
six years4
would you4
may039s vow4
astronaut peggy4
peggy whitson4
donald trump4
brexit cash4
fabulous exclusive4
shows off4
amazing new4
high street4
premier league4
rewards club4
little girl4
after he4
gas explosion4
david davis4
thesunadcmd thesunadcmdpush4
thesunadcmd thesunadcmd4
function var4
var thesunadcmd4
boris johnson4
thesunadcmdpush function4
sun bingo4
sun savers4
sun bets4
sun sun4
pc bid3
dresses unisex3
opens up3
makes floral3
floral dresses3
shelling out3
more than3
function function3
news revealed3
function displayad3
displayad windowthesunadcmd3
even makes3
go into3
039girls039 kids0393
gender neutral3
neutral top3
ever built3
has ever3
lego set3
company has3
top high3
windowthesunadcmd windowthesunadcmd3
scraps 039boys0393
irish sun3
store scraps3
street store3
group newspapers3
kids039 clothes3
showbiz competition3
going back3
brawl breaks3
but there039s3
north korea3
may have3
breaks out3
can watch3
contact us3
holiday weekend3
dear deidre3
coleen rooney3
first time3
holly willoughby3
explosive storyline3
bradley lowery3
new lego3
nuclear test3
korean nuclear3
new york3
explosion but3
game4grenfell charity3
storyline eastenders3
must not3
has been3
news comment3
bets sun3
david beckham3
star wars3
fox covering3
covering eyebrows3
silver fox3
pricey problems3
expensive solutions3
very pricey3
tin foil3
foil like3
but would3
after two3
trend but3
beauty trend3
latest bonkers3
bonkers beauty3
these expensive3
their wealth3
denim jacket3
jacket ever3
impractical denim3
most impractical3
than any3
out net-a-porter3
sleeves down3
your knees3
rich kids3
snapchatflaunt their3
antics rich3
starts fight3
fell asleep3
dinghy starts3
you try3
after they3
after damning3
damning pictures3
back after3
money back3
demand their3
their money3
pictures emerge3
plus get3
wars fans3
going bonkers3
she doesn039t3
chewbricker star3
our rewards3
windowthesunadcmdpush function3
floods demand3
never floods3
truth comes3
comes flooding3
scottish sun3
never going3
after leaving3
mental health3
flooding out3
out couple3
previous owners3
owners claimed3
after previous3
750k home3
bought 750k3
windowthesunadcmd windowthesunadcmdpush3
news105
after76
tv64
her59
you56
showbiz53
amp53
his49
out45
sun42
your40
new36
she35
their34
fabulous33
have33
he32
home30
back29
but28
exclusive28
up27
has27
football26
latest26
baby22
these21
function21
off21
get21
most19
not19
kids19
make18
could18
our17
one17
reveals17
more17
can17
star17
being17
brexit16
them16
sex16
go15
into15
charity15
down15
all15
show15
three14
fantasy14
they14
now14
us14
mum14
going14
x14
car14
just14
so14
no14
over14
time14
wayne14
here039s14
best13
fans13
girl13
uk13
win13
years13
rooney13
we12
love12
left12
match12
price12
like12
says12
family12
school12
woman12
week12
never12
life12
big12
may12
street12
holiday12
music11
first11
money11
around11
which11
days11
set11
people11
david11
free10
were10
katie10
man10
two10
sport10
tips10
north10
hours10
inside10
him10
team10
why10
selling10
ever10
eu10
it039s9
hot9
made9
game9
nuclear9
than9
can039t9
test9
dream9
09
couple9
even9
while9
secret9
do9
online9
competition9
day9
grenfell9
other9
horror9
husband9
earth9
six9
cash9
googletagdisplay9
space8
18
should8
five8
look8
bank8
watch8
thesunadcmd8
claims8
want8
need8
she039s8
cheryl8
including8
stars8
night8
before8
deal8
theresa8
top8
revealed7
little7
summer7
travel7
start7
battle7
wedding7
because7
found7
very7
take7
recipes7
parents7
dead7
would7
if7
find7
admits7
party7
live7
holly7
high7
king7
factor7
here7
fan7
sign7
video7
right7
fit7
world7
election7
comes7
escape6
former6
calls6
much6
follow6
stop6
insists6
way6
sale6
bargain6
store6
say6
house6
documentaddeventlistenerdomcontentloaded6
dress6
brexit0396
four6
england6
september6
korean6
league6
story6
moment6
beach6
trump6
harry6
huge6
bid6
ten6
primark6
tech6
my6
goal6
work6
girlfriend6
displayad6
had6
food6
windowthesunadcmd6
gets6
planning6
divorce6
thousands6
festival6
put6
dad6
game4grenfell6
fitness6
break6
worth6
some6
try6
hit6
bonkers6
amazing6
039i6
incredible6
beauty6
health5
told5
biggest5
change5
25
britain039s5
outdoor5
pm5
may039s5
comment5
singer5
reveal5
plans5
sleeves5
close5
problems5
queen5
buy5
return5
better5
corbyn5
fight5
labour5
body5
son5
tell5
used5
died5
east5
know5
road5
site5
line5
enjoy5
brawl5
bought5
police5
fortune5
british5
families5
club5
videos5
makes5
pay5
plus5
don039t5
shows5
spotted5
model5
scheme5
been5
35
use5
date5
during5
opening5
august5
name5
hayler5
bradley5
kieran5
britain5
only5
second5
boss5
easy5
ex5
var5
trying5
holidays5
morning5
coleen5
using5
diesel5
help5
conditions5
movies5
terms5
its5
johnson5
country5
returning5
another5
gas5
scrappage5
child5
thomas5
stone5
previous5
season5
black5
event4
built4
cool4
eastenders4
explosion4
trip4
wars4
must4
scraps4
link4
scrap4
wants4
guide4
davis4
floral4
clothes4
trevor4
slams4
rewards4
always4
believe4
thanks4
rae4
sunshine4
nicole4
plan4
rules4
cheating4
tribute4
horrified4
starts4
breast4
snap4
exactly4
stunning4
decision4
truth4
apple4
44
tourist4
phone4
boris4
london4
uk039s4
savers4
favourite4
taking4
there039s4
tory4
vow4
next4
blanket4
bingo4
services4
death4
rock4
third4
jamie4
bets4
face4
cronies4
company4
astronaut4
happy4
perfect4
korea4
garden4
any4
action4
brits4
donald4
staff4
warning4
spanish4
whitson4
tenerife4
peggy4
demand4
premier4
fire4
until4
prime4
eight4
private4
weight4
54
meet4
factor039s4
everton4
loving4
hand4
paris4
doesn039t4
thing4
ticket4
yet4
session4
appy4
ultimate4
rich4
sweet4
record-breaking4
kids0394
64
me4
wild4
thesunadcmdpush4
copy4
deals4
abuse4
paul4
ferry4
moving4
venice4
hilarious4
past4
keep4
desert4
killed4
adam4
still4
massive4
through4
website4
many4
having4
film4
slammed4
cops4
pricey4
parenting3
state3
victoria3
00433
truly3
property3
73
months3
willoughby3
sports3
goals3
row3
furious3
gangs3
breaks3
fails3
future3
group3
gang3
pregnant3
newspapers3
asking3
wrong3
taken3
blocking3
order3
skin3
along3
see3
shares3
catch3
wanting3
flat3
saving3
opens3
history3
brave3
kid3
whole3
babies3
birthday3
tumble3
wife3
got3
local3
wait3
ultra3
visit3
french3
rest3
give3
kate3
theres3
tiny3
getting3
good3
park3
room3
mistakes3
tries3
texas3
year3
driver3
transfers3
weekend3
brady3
friends3
sunday3
there3
039to3
megan3
eye3
pretty3
volkswagen3
dog3
human3
spoiler3
camp3
shopping3
looks3
send3
popular3
away3
lost3
sleep3
punches3
reason3
plane3
pizza3
bring3
fun3
fly3
range3
eid3
above3
romantic3
items3
flight3
christmas3
planet3
covering3
shocking3
perform3
naked3
every3
woodburn3
axed3
confesses3
move3
launched3
offer3
tears3
fighting3
windowthesunadcmdpush3
coming3
bake3
houses3
fat3
card3
83
feared3
drink3
arrested3
relationship3
end3
throwing3
dinghy3
asleep3
fell3
island3
young3
west3
politics3
per3
accused3
knees3
jacket3
times3
blast3
hits3
decade3
white3
prepare3
denim3
impractical3
net-a-porter3
sleeve3
judges3
holds3
least3
tax3
bomb3
together3
united3
evil3
announces3
nothing3
strike3
93
since3
deidre3
york3
irish3
scottish3
media3
post3
complaints3
dear3
motors3
contact3
syndication3
expecting3
explosive3
lowery3
murs3
turning3
condition3
thrones3
proves3
beckham3
care3
daddy3
throne3
diagnosed3
support3
became3
die3
rocked3
storyline3
last3
holes3
brain3
tongue3
american3
raise3
cancer3
worst3
shelling3
costs3
pc3
royal3
delay3
head3
jolie3
homes3
neighbours3
unisex3
dresses3
diet3
facebook3
emerge3
pictures3
chewbricker3
lego3
039girls0393
039boys0393
neutral3
gender3
come3
sick3
payne3
industry3
footsteps3
dad039s3
arrives3
married3
emotional3
hotel3
tony3
bikini3
lead3
joins3
fridge3
heartbroken3
silent3
said3
friend3
jo3
praised3
anyone3
poll3
damning3
floods3
watching3
kasaei3
geordie3
shore3
silver3
fox3
takeaway3
foil3
tin3
eyebrows3
solutions3
expensive3
things3
saturday3
nanny3
behind3
herself3
chocolate3
wealth3
snapchatflaunt3
antics3
103
trend3
booze3
missing3
place3
become3
taylor3
needs3
ahead3
claimed3
owners3
750k3
flooding3
jose3
key3
read3
year039s3
leaving3
hour3
isn039t3
women3
able3
hold3
mental3
princess3

What are the nameservers for thesun.co.uk?

Thesun.co.uk Domain Nameserver Information

HostIP AddressCountry
use1.akam.net 72.246.46.64United States United States
use2.akam.net 96.7.49.64United States United States
use3.akam.net 96.7.49.65United States United States
usw2.akam.net 184.26.161.64United States United States

Thesun.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Thesun.co.uk is a scam?