Weston-super-Mare news, events and sport - Weston Mercury

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: 223,379
Estimated Worth: $94,800
Category: News and Media

Latest Weston-super-mare news including local breaking news stories, sport, weather and what's on in Weston from Weston Mercury.



Domain summary

Last updated
2020-10-11
Domain label
thewestonmercury
Domain extension
co.uk
Domain registered:
2000-07-10
Domain updated:
2014-06-09
Domain expires:
0000-00-00
Global Traffic Rank
223,379
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$94,800
Estimated daily income
$158
Estimated monthly income
$4,806

Rank summary

How is thewestonmercury.co.uk ranked relative to other sites:

Percentage of visits to thewestonmercury.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Thewestonmercury.co.uk registered?
A: Thewestonmercury.co.uk was registered 20 years, 9 months, 1 week, 2 days, 3 hours, 34 minutes ago on Monday, July 10, 2000.
Q: When was the WHOIS for Thewestonmercury.co.uk last updated?
A: The WHOIS entry was last updated 6 years, 10 months, 1 week, 3 days, 3 hours, 34 minutes ago on Monday, June 9, 2014.
Q: What are Thewestonmercury.co.uk's nameservers?
A: DNS for Thewestonmercury.co.uk is provided by the following nameservers:
  • ns-1520.awsdns-62.org
  • ns-1756.awsdns-27.co.uk
  • ns-426.awsdns-53.com
  • ns-905.awsdns-49.net
Q: Who is the registrar for the Thewestonmercury.co.uk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Thewestonmercury.co.uk?
A: Thewestonmercury.co.uk ranks 223,379 globally on Alexa. Thewestonmercury.co.uk has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Thewestonmercury.co.uk each day?
A: Thewestonmercury.co.uk receives approximately 12,664 visitors and 63,320 page impressions per day.
Q: What IP address does Thewestonmercury.co.uk resolve to?
A: Thewestonmercury.co.uk resolves to the IPv4 address 46.137.178.24.
Q: In what country are Thewestonmercury.co.uk servers located in?
A: Thewestonmercury.co.uk has servers located in the Ireland.
Q: What webserver software does Thewestonmercury.co.uk use?
A: Thewestonmercury.co.uk is powered by Unknown webserver.
Q: Who hosts Thewestonmercury.co.uk?
A: Thewestonmercury.co.uk is hosted by Amazon.com, Inc. in Leinster, Dublin, Ireland.
Q: How much is Thewestonmercury.co.uk worth?
A: Thewestonmercury.co.uk has an estimated worth of $94,800. An average daily income of approximately $158, which is roughly $4,806 per month.

Thewestonmercury.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Thewestonmercury.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Thewestonmercury.co.uk

H1 Headings

1 :
  1. 0

H2 Headings

1 :
  1. 29

H3 Headings

1 :
  1. 35

H4 Headings

1 :
  1. 6

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

1 :

Total Images

98 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-63223733-9

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Thewestonmercury.co.uk

thubottompadding 10pxgawindowinnerwidth 1024 googletagcmdpushfunctionfricarouselcontrol glyphiconchevronleftmarine lakehas beencompetitionsafterwidgets property2020 carringtongasend event socialmercury eedition dailythisgetattributedisplaytextgoogleplusseptembertwitterimg heightundefined gasend0900eeditionitemcard imggasend eventsocial shareread moresportfontsizereturnthursday october 1absolutelakeyesterdaysolidleaguefixinputcharsyoutubeopenedfloat leftus send8pxulbusinessesiwitness24theatreworld1024 googletagcmdpushfunctionlandpropertyfontweightdrivein christmassaturdayhispublicnewsletterteaserimagecarrington walkershare buttons click728 googletagcmdpushfunctionmercury eeditionheightifwindowinnerwidth 728 windowinnerwidththomaslatestus send usifwindowinnerwidth 1024marginbottom 10pximgpeopledailylilengthif jsonloginstatusloggedinproperty newslettersother45pxmyrunmenuresizefirstiftypeofopacityfreeevent social sharestorylistmostreadsendborderwidgets property newslettersdisplay blockposition absolutedriveingasendmoatintervalthursday october15pxiftypeof ga undefinednone5pxdismalandablega undefined gasend2020 lilyoctober 1sitetakemorecouncilsend uswalker bristol airportifwindowinnerwidth 728socialtopcontentb storylistmostread teasertitleif typeofaugustfirst driveinhostmargintopshowadvertisefamilymarginleft 15pxlocal businessesfontweight boldopenspatientweston mercury eeditionwindowinnerwidthpublic noticesmarginairportvarticketsstorylistmostread teasertitlefeaturebarloginemptyappend logdrinkitemcardheight autoitemlimitrss and widgetsweston mercurytownnewsletter rssreadfloatgetcarenorth somersetfacebook1728 windowinnerwidth 1024lily newtonbrownehavetoday10pxgolfjsonloginstatusloggedinabeforehomemercury0900 vicky angear1024pxtargetififwindowinnerwidthbuttonslihoverchristmasvicky angearinto1 2020 carringtonfourtruenewscolorhiddendaily newsletterfoodnoticesusefullinks youtubesocial share buttonscontentbmentalmarginbottommediausresultsgt22020 lily newtonbrowne25pxnewsletters public noticeslineheightjoshrestaurantsundefined gasend eventwestonrsquosprofileeedition dailydisplay nonecarouselinnershare buttons20px0900 vickyreturn falseboldbackgroundimagepantomimeschoolbeencarringtonfeaturebarloginemptyappendusefullinks googleplusjobspaddingdaily newsletter rsswalker bristollinksiftypeof gaus a storypositioncontentb storylistmostreadupga undefineditsmarinelastwindowwidthoutcontact usnewjqueryverticalscarouselcontrolmy profileifwindowinnerwidth 1024 googletagcmdpushfunctionfunctionusefullinks facebookmarginleftboroughnorthfaqnone verticalsway2harrow boroughtropicana1 2020closewindowinnerwidth 1024numberchainmarginrightheaderextrassearchmedia maxwidthcontent6harrowcontentb storylistmostreadteasercounter teaserimageusefullinks twittersomersetrightread more westonnewsletterswidthmental healthfalsejosh thomascontentb storylistmostreadteasercountermytimeoutsharefridayeeditionundefined2020 carrington walkerclickbuttons clickwestoneeditionitemcardcoffeeverticals lihovercontactbusinessbristoldinelilycarouselcontrol glyphiconchevronrighteventnull0pxbristol airportangear3widgetsevent sociallogelseblockrssgoogletagcmdpushfunctionentertainmentarchantverticalsfood and drinkeedition daily newsletterstorylistmostreadteasercounterhealth4abefore backgroundimagethursdayupdatemenuitemwidths0h2width 100more westonoctoberpantoglyphiconchevronleft728 windowinnerwidthnewsletters publiccoronavirustypeofusefullinksdisplayifwindowinnerwidth 728 googletagcmdpushfunctionfirst drivein christmashasmaxwidtheducationproperty newsletters publicnewtonbrownelocalstorylistmostreadteasercounter teaserimagetrainingstorymargin 0pxautoleftsettingmarginright 8px30px5premiervickyteasertitlewalkerweekoctober 1 2020carrington walker bristolglyphiconchevronright

Longtail Keyword Density for Thewestonmercury.co.uk

KeywordsOccurences
ifwindowinnerwidth 728 windowinnerwidth10
ifwindowinnerwidth 1024 googletagcmdpushfunction10
728 windowinnerwidth 102410
windowinnerwidth 1024 googletagcmdpushfunction10
ifwindowinnerwidth 728 googletagcmdpushfunction9
2020 lily newton-browne5
iftypeof ga undefined4
ga undefined gasend4
2020 carrington walker4
read more weston4
walker bristol airport4
carrington walker bristol4
first drive-in christmas4
newsletters public notices4
property newsletters public4
widgets property newsletters4
rss and widgets4
gasend event social4
e-edition daily newsletter4
mercury e-edition daily4
undefined gasend event4
weston mercury e-edition4
daily newsletter rss4
content-b story-listmost-read teaser-title3
1 2020 carrington3
october 1 20203
thursday october 13
share buttons click3
event social share3
social share buttons3
0900 vicky angear3
us a story3
us send us3
food and drink3
content-b story-listmost-readteaser-counter teaser-image3
read more27
1024 googletagcmdpushfunction20
ifwindowinnerwidth 72819
728 windowinnerwidth10
windowinnerwidth 102410
ifwindowinnerwidth 102410
728 googletagcmdpushfunction9
vicky angear9
weston mercury8
display block8
if typeof6
carrington walker6
bristol airport6
lily newton-browne6
mercury e-edition5
contact us5
2020 lily5
carousel-control glyphicon-chevron-right5
local businesses5
share buttons5
position absolute5
float left5
north somerset4
2020 carrington4
iftypeof ga4
width 1004
content-b story-listmost-readteaser-counter4
font-weight bold4
content-b story-listmost-read4
first drive-in4
1 20204
newsletters public4
drive-in christmas4
walker bristol4
event social4
gasend event4
marine lake4
more weston4
public notices4
property newsletters4
ga undefined4
featurebarloginemptyappend log4
abefore background-image4
display none4
media max-width4
widgets property4
my profile4
height auto4
e-edition daily4
daily newsletter4
newsletter rss4
undefined gasend4
story-listmost-read teaser-title3
story-listmost-readteaser-counter teaser-image3
october 13
margin-left 15px3
carousel-control glyphicon-chevron-left3
thursday october3
margin-left -15px3
e-edition-item-card img3
img height3
useful-links google-plus3
josh thomas3
us send3
useful-links facebook3
useful-links you-tube3
padding 10px3
verticals lihover3
none verticals3
margin 0px3
return false3
send us3
harrow borough3
margin-bottom 10px3
margin-right 8px3
mental health3
0900 vicky3
if jsonloginstatusloggedin3
useful-links twitter3
has been3
social share3
buttons click3
weston32
ifwindowinnerwidth29
googletagcmdpushfunction29
read29
more27
var24
width21
021
function21
119
height17
215
useful-links15
display14
verticals13
margin-left12
e-edition12
out12
us12
if12
news12
0px11
fri10
font-size10
else10
margin-top10
windowinnerwidth10
310
after10
vicky9
thursday9
none9
10px9
angear9
media9
top9
mercury9
first9
bristol8
local8
content-b8
left8
15px8
block8
carousel-control8
padding8
today7
color7
september7
somerset7
img7
typeof7
position7
social7
47
people6
newton-browne6
airport6
property6
walker6
carrington6
notices6
e-edition-item-card6
saturday6
christmas6
theatre6
has6
show6
lily6
content6
float6
20px6
businesses6
margin-right6
margin6
auto6
health6
buttons6
glyphicon-chevron-right5
ga5
iftypeof5
business5
undefined5
his5
click5
event5
world5
share5
family5
absolute5
four5
carousel-inner5
care5
abefore5
55
jqueryverticals5
25px5
30px5
font-weight5
return5
contact5
bold4
item-card4
null4
august4
opens4
coffee4
league4
new4
featurebarloginemptyappend4
harrow4
story-listmost-readteaser-counter4
story-listmost-read4
teaser-image4
westonrsquos4
5px4
tickets4
drive-in4
setting4
-15px4
lake4
marine4
free4
have4
host4
friday4
october4
log4
dismaland4
margin-bottom4
food4
facebook4
sport4
north4
max-width4
true4
twitter4
public4
header-extras4
newsletters4
widgets4
rss4
iwitness244
newsletter4
daily4
profile4
false4
ul4
gasend4
border4
results-gt-24
8px4
bottom4
story4
my4
line-height4
background-image4
lihover4
close3
right3
dine3
chain3
training3
target3
thomas3
able3
get3
restaurants3
opened3
itemlimit3
45px3
fixinputchars3
moatinterval3
thisgetattributedisplaytext3
glyphicon-chevron-left3
mytimeout3
lastwindowwidth3
63
borough3
number3
jsonloginstatusloggedin3
links3
updatemenuitemwidths3
lilength3
teaser-title3
runmenuresize3
h23
josh3
1024px3
solid3
faq3
golf3
into3
other3
been3
latest3
entertainment3
competitions3
jobs3
drink3
take3
council3
send3
09003
yesterday3
mental3
patient3
archant3
tropicana3
panto3
up3
premier3
school3
you-tube3
thu3
way3
google-plus3
hidden3
search3
advertise3
land3
opacity3
week3
town3
its3
home3
coronavirus3
pantomime3
education3
site3

Who hosts Thewestonmercury.co.uk?

Thewestonmercury.co.uk Hosting Provider Information

Hosted IP Address:46.137.178.24
Hosted Hostname:ec2-46-137-178-24.eu-west-1.compute.amazonaws
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.3389
Location Longitude:-6.2595
Webserver Software:unknown

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Thewestonmercury.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved permenantly
Date: Sun, 11 Oct 2020 19:57:14 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Server: Varnish
Location: https://thewestonmercury.co.uk/
Accept-Ranges: bytes
X-Varnish: 729332259
Age: 0
Via: 1.1 varnish
X-Cache: MISS

Thewestonmercury.co.uk Domain Nameserver Information

HostIP AddressCountry
ns-1520.awsdns-62.org 205.251.197.240
ns-1756.awsdns-27.co.uk 205.251.198.220
ns-426.awsdns-53.com 205.251.193.170
ns-905.awsdns-49.net 205.251.195.137


Need to find out who hosts Thewestonmercury.co.uk?


Domain Registration (WhoIs) information for Thewestonmercury.co.uk

 Domain name:
thewestonmercury.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 27-May-2018

Registrar:
Gandi [Tag = GANDI]
URL: http://www.gandi.net

Relevant dates:
Registered on: 10-Jul-2000
Expiry date: 10-Jul-2021
Last updated: 05-Jun-2020

Registration status:
Registered until expiry date.

Name servers:
ns-1520.awsdns-62.org
ns-1756.awsdns-27.co.uk 205.251.198.220
ns-426.awsdns-53.com
ns-905.awsdns-49.net

WHOIS lookup made at 10:31:04 07-Jun-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Thewe.biz
   TheWE.biz   News articles not seen in mainstream media     
Thewe.cafe
The We at Highland Lake Cove | Retreat & Learning Community
Thewe.cc
   TheWE.cc   News articles not seen in mainstream media      
Thewe.network
thewe.network - Registered at Namecheap.com
Thewe.tech
Default OaO Frameset
Thewe2.com
We2 App | Nice Dating App on Android

Recently Updated Websites

Davieshomehealth.com (1 second ago.)Chaletsavendre.com (1 second ago.)Shedreamsofbeauty.com (2 seconds ago.)Mullystouchofireland.com (3 seconds ago.)Tyc3494.com (3 seconds ago.)Giftmybag.com (3 seconds ago.)Isonation.live (3 seconds ago.)Smkdata.com (3 seconds ago.)Cafeina.info (3 seconds ago.)Express-trans.com (3 seconds ago.)Q--h.com (3 seconds ago.)Leticia-photography.com (3 seconds ago.)Ztecnet.net (4 seconds ago.)Gimassage.com (4 seconds ago.)Lighthousebaptistchurch-va.com (5 seconds ago.)Decorviral.com (5 seconds ago.)Crowellservicegroup.com (5 seconds ago.)Ivegotone.com (5 seconds ago.)Quartierdesfemmes.com (6 seconds ago.)Classroomsize.org (6 seconds ago.)Megapic.ru (6 seconds ago.)Youthforia.world (6 seconds ago.)Pul.com (6 seconds ago.)Christicampbell.net (6 seconds ago.)4virtus.com (6 seconds ago.)Gore.com (6 seconds ago.)Grangernedical.com (7 seconds ago.)Telcocurrency.com (7 seconds ago.)Unifiedbusinesssystems.co.uk (7 seconds ago.)Ybyl6228.com (7 seconds ago.)

Recently Searched Keywords

industry synonym (15 seconds ago.)httpsschemaorg type (23 seconds ago.)erp (24 seconds ago.)33 33 (27 seconds ago.)t- shirts (30 seconds ago.)“thanh niên với tình bạn, tình yêu, gia đình và quyên góp ủng hộ đồng bào miền trung” tại trường thpt tân trào (35 seconds ago.)turkey (37 seconds ago.)bbnl customer care (42 seconds ago.)hair (44 seconds ago.)more than (46 seconds ago.)aller (50 seconds ago.)width 200px media (52 seconds ago.)err err (55 seconds ago.)electric stair lifts (56 seconds ago.)fee (57 seconds ago.)new ca0 (58 seconds ago.)north nj (1 minute 1 second ago.)di boat (1 minute 4 seconds ago.)もっと読む (1 minute 8 seconds ago.)podcast-pr-lumetri_1.mp4 (1 minute 9 seconds ago.)y web (1 minute 13 seconds ago.)“thanh niên với tình bạn, tình yêu, gia đình và quyên góp ủng hộ đồng bào miền trung” tại trường thpt tân trào (1 minute 13 seconds ago.)help center (1 minute 16 seconds ago.)industry definition (1 minute 17 seconds ago.)eu privacy notice (1 minute 19 seconds ago.)top drivers of all-time (1 minute 19 seconds ago.)link-area-box-hoverlink-area-box fusion-read-more (1 minute 22 seconds ago.)massage 8th ave kalgoorlie (1 minute 22 seconds ago.)20 34 46 (1 minute 23 seconds ago.)0 0 3px (1 minute 26 seconds ago.)