|  Thomann
High trust score  | Website Information has a High trust score, a Statvoo Rank of B, an Alexa Rank of 1,596, a Majestic Rank of 6,985, a Domain Authority of 76% and is not listed in DMOZ. is hosted by M-net Telekommunikations GmbH, Germany in Bayern, Erlangen, Germany, 91052. has an IP Address of and a hostname of

The domain was registered 201 decades 9 years 1 day ago by , it was last modified 8 years 6 months 2 weeks ago and currently is set to expire 201 decades 9 years 1 day ago.

Whois information for

Full Whois Lookup for Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2015-08-18T12:45:22+02:00

Name: Netzmarkt Hostmaster
Organisation: Netzmarkt Internetservice GmbH & Co. KG
Address: Henkestr. 77
PostalCode: 91052
City: Erlangen
CountryCode: DE
Phone: +49-9131-974760
Fax: +49-9131-9747666
Email: Login to show email
Changed: 2011-03-28T14:40:21+02:00

Name: Netzmarkt Hostmaster
Organisation: Netzmarkt Internetservice GmbH & Co. KG
Address: Henkestr. 77
PostalCode: 91052
City: Erlangen
CountryCode: DE
Phone: +49-9131-974760
Fax: +49-9131-9747666
Email: Login to show email
Changed: 2011-03-28T14:40:21+02:00

Who hosts Web Server Information

Hosted IP Address:
Service Provider:M-net Telekommunikations GmbH, Germany
Hosted Country:GermanyDE
Location Latitude:49.5956
Location Longitude:10.995
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 08 Jun 2015 20:20:18 GMT
Server: Apache
X-Frame-Options: SAMEORIGIN
Content-Encoding: gzip
Vary: Accept-Encoding
Content-Length: 2569
Connection: close
Content-Type: text/html

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

equipment lighting3djmilleniumwe haveequipment softwaretblogscarlettusbmusictwitterhb20b12upcases rackspa10akaimoreeuro145 pound133988ld systems mauiwishsystems mauieffectseuro125 pound11550pa equipment lightingsheetequipshymentbenton hb20bbacklitinstruments traditionalbentoncanmmnewsledequipment microphonesspotaudiocustomsoundboks 2benton hb20b 2017quickbrazilfrequencydigitalldj equipmentpaypalstoreaddresstogetherld systemsnew newpercussion keys3bandyamahadvds cases racksoutputsetgobackstage djshurevolumepa equipmentmk2findbasspound11550jbl lsrpagesendourhot dealsguitars and basses7ownheadrushnewstagebuttonsbehringerrangeequipment software pamovingshop0servicepowerpound13398pound7115warrantytraditional sheetwindbags cablesequipment microphones effectshavethomannproductsrankguitarswhatsplugs accessoriesprocpercussionchooselcjbl lsr 305casebecomedrumspopularunitedanystackingdelayverycontrol5euro77 pound7115software pafocusrite scarlettmoneyheadphone output2completefenderdvdsndashdatalayer11responsivephat static3ampwhichrolandeuro109videoseuro686cableshow allarrowstop responsivephathelptrackinstrumentswind instrumentsbasseseuro109 pound10071islandscablesbagslsrjblmaui 11republicwind instruments traditionalyou will findsoundboks the soundbokslightingfacebookfeedbackpercussion keys studioharley bentonstage dj equipmentfreepaylc euro109 pound10071weretop sellerseuro77safeeasysellerseuro125headphonecircuitpaymentmoney backoverviewarrowstop responsivephat static3lddmxrecommendedyearnew new neweuro469microphones effectsmusishycianswantmake13dbbasses drumstopchoose yourmini1boxpaidusnowsystemsspeakermoving headwish listkeys studioxonlineputsoftware pa equipmentbstockchairweshowhotlc euro109you canstudiosouthcentreeuro849pound10071difshyferentbrandsoneyourmkiihb20b 2017kampmyour ownpershyfectliketraditionalelectricsignalmauiharley benton hb20bstatic3pesosheadrush pedalboardmobiledealssavehead2ndsecuritykeyscomboeuro145xtouchpedalboardcontactproductdvds casesresponsivephataccessoriesrightgenextendermusicians chairamazontheseorderprov2guaranteelist4dollarsmanyiconcasesallnoblack2nd genpayment securitybookssoundroderecordinggreatlsr 305focusritearrowstopsoftwarepoundplugsstairvillesignal procstsoundboksguitarmicrophones9dj equipment microphonesmusiciansharleythobootstrapmodulecommonrsslicksliderequipmentracksyou

Longtail Keyword Density for

you will find4
soundboks the soundboks4
jbl lsr 3053
lc euro109 pound100713
harley benton hb-20b3
benton hb-20b 20173
arrowstop responsive-phat static-33
ld systems maui3
new new new3
dvds cases racks3
software pa equipment3
equipment software pa3
percussion keys studio3
pa equipment lighting3
stage dj equipment3
wind instruments traditional3
equipment microphones effects3
dj equipment microphones3
guitars and basses3
harley benton10
you can8
wish list5
new new4
headrush pedalboard4
hot deals4
show all4
top sellers4
soundboks 24
focusrite scarlett4
keys studio4
software pa4
euro77 pound71154
responsive-phat static-34
2nd gen4
jbl lsr3
euro109 pound100713
lsr 3053
hb-20b 20173
musicians chair3
arrowstop responsive-phat3
your own3
headphone output3
moving head3
systems maui3
euro125 pound115503
benton hb-20b3
lc euro1093
ld systems3
euro145 pound133983
we have3
equipment software3
pa equipment3
equipment lighting3
stage dj3
percussion keys3
basses drums3
choose your3
signal proc3
traditional sheet3
dj equipment3
equipment microphones3
bags cables3
plugs accessories3
maui 113
money back3
cases racks3
dvds cases3
microphones effects3
wind instruments3
instruments traditional3
payment security3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Germany Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?