TierrArt Créations, comment votre communication devient facile.

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Illustrateur et infographiste en freelance, je travaille en communication visuelle, pour l’édition, les PME, les indépendants, le web et l’audiovisuel. Auteur de bandes dessinées, mattepainter et peintre numérique, mes compétences sont appréciées dans la recherche graphique et la conception de séquences et de décors. Formateur indépendant sur Ad...



Domain summary

Last updated
2021-04-14
Domain label
tierr
Domain extension
fr
Domain registered:
2006-06-23
Domain updated:
2021-03-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Tierr.fr registered?
A: Tierr.fr was registered 15 years, 5 months, 1 week, 3 days, 20 hours, 43 minutes, 19 seconds ago on Friday, June 23, 2006.
Q: When was the WHOIS for Tierr.fr last updated?
A: The WHOIS entry was last updated 8 months, 1 week, 5 days, 20 hours, 43 minutes, 19 seconds ago on Monday, March 22, 2021.
Q: What are Tierr.fr's nameservers?
A: DNS for Tierr.fr is provided by the following nameservers:
  • dns15.ovh.net
  • ns15.ovh.net
Q: Who is the registrar for the Tierr.fr domain?
A: The domain has been registered at AFNIC.
Q: What is the traffic rank for Tierr.fr?
A: Tierr.fr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Tierr.fr each day?
A: Tierr.fr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Tierr.fr resolve to?
A: Tierr.fr resolves to the IPv4 address 213.186.33.2.
Q: In what country are Tierr.fr servers located in?
A: Tierr.fr has servers located in the France.
Q: What webserver software does Tierr.fr use?
A: Tierr.fr is powered by Apache webserver.
Q: Who hosts Tierr.fr?
A: Tierr.fr is hosted by OVH SAS in France.
Q: How much is Tierr.fr worth?
A: Tierr.fr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Tierr.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tierr.fr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Tierr.fr

H1 Headings

2 :
  1. BIENVENUE SUR LE SITE DE
  2. Créateurs d’entreprises

H2 Headings

5 :
  1. Les bases de la communication
  2. La communication PRO
  3. Pour réussir votre évènementiel
  4. La solution pour être vu
  5. Coordonnées :

H3 Headings

21 :
  1. Pour être connu, vous devez être vu.
  2. Alors, laissez-nous traduire avec esthétisme et originalité votre projet
  3. Illustrateur et infographiste en freelance, je travaille en communication visuelle, pour l’édition, les PME, les indépendants, le web et l’audiovisuel.
  4. Auteur de bandes dessinées, mattepainter et peintre numérique, mes compétences sont appréciées dans la recherche graphique et la conception de séquences et de décors.
  5. Formateur indépendant sur Adobe Photoshop et Corel Painter, je dispense des cours en photomontage et mattepainting, dans des centres de formation et en université.
  6. Parce qu’il est important de vous démarquer et d’affirmer votre identité
  7. Nous avons conçu pour vous des packs de communication essentiels
  8. SOLO STARTER KIT
  9. BUSINESS STARTER KIT
  10. ÉVÈNEMENT STARTER KIT
  11. PRINTWEB STARTER KIT
  12. Edeka, des pubs pas comme les autres
  13. Nouveautés de Photoshop CC 2018
  14. Transformer vos photos couleur en photos noir & blanc intense
  15. Tutoriel Photoshop – Styles de calques additifs
  16. L’univers morbide et déjanté de Sabbas Apterus
  17. Template Photoshop, effet bande dessinée
  18. Corel PAINTER 2018, les nouveautés.
  19. La licence professionnelle ATC design numérique 2017 à l’IUT de Corse
  20. Template Photoshop pour un effet de peinture aquarelle.
  21. L’art d’Adam Brockbank

H4 Headings

11 :
  1. IDENTITÉ VISUELLE
  2. COMMUNICATION
  3. ILLUSTRATION
  4. BANDE DESSINÉE
  5. MATTE PAINTING
  6. PHOTO MONTAGE
  7. WEB DESIGN
  8. FORMATION
  9. ADRESSE POSTALE :
  10. TÉLÉPHONE :
  11. EMAIL :

H5 Headings

4 :
  1. Un renseignement, un devis, une demande de formation, un bonjour, n’hésitez pas à nous contacter.
  2. 12, rue de la Grille 10100 Romilly-sur-Seine – FRANCE
  3. (+33) 06 66 40 68 90
  4. Formulaire de contact

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

44 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-50620933-1

Links - Internal

60:

Links - Outbound (nofollow)

0:

Keyword Cloud for Tierr.fr

opensowldotnotactivehoverque1var timeridnullvarxnew datevar nowxgettimevarlesvotrenownew datevarlarticlescreenvisitestarterprix ttcpour lesnowxgettimevar gmt16183909131000var diffmsnowgmtcommunicationphotosplusopens in newspanboxshadowinset 0 0startclockstopclockshowtime varweb etnownewblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baasurdatemydiffmstimeridsettimeoutshowtime10000timerrunning0 function startclockstopclockshowtimecommentairedatevar nowxgettimevar gmt16183909131000vardatevar mynowgettimenownew datemydiffmstimeridsettimeoutshowtime10000timerrunning0xnewgmt16183909131000varsur leprojet2017 lire larticleff3a2dbulletsfillinblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baagraphiquetimerrunning1var xnewavecdatemydiffmstimeridsettimeoutshowtime10000timerrunning0 functionvisuelsite weblire larticleowlnavstopclockiftimerrunningcleartimeouttimeridtimerrunning1 functionmynowgettimenownew0 0function startclockstopclockshowtimeprixshowtimevarnowxgettimevarvouscmplzslider0 0 2pxtrefunctionmshighcontrastnoneblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baaetsitepageall and mshighcontrastnoneblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baapage openstimeridnullvar timerrunning1varoctobreaussinespanbackgroundff3a2dboxshadownonebulletsetefublogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baa0 2pxestune2lirestopclockiftimerrunningcleartimeouttimeridtimerrunning1 function showtimevarformationcontacteznouscration0timerrunning1vartimeridnullvar timerrunning1var xnew2pxblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baacenteredlayoutlistjedansshowtimevar nownew datevarnoimgmynowgettimenownew datemydiffmstimeridsettimeoutshowtime10000timerrunning0documentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1 functionprix ttc contacteznouscrationgmt16183909131000var diffmsnowgmtdatevar nowxgettimevarspanboxshadowinset 0photoshopdocumentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1passharepourlestartclockstopclockshowtime var timeridnullvarttcfunction showtimevarwebstopclockiftimerrunningcleartimeouttimeridtimerrunning1contacteznouscration de votrenousoctobre 2017 liredatevarcookiesnotreflyers0 0 0diffmsnowgmtcartes de visiteunfunction startclockstopclockshowtime varouallshowtimevar nownewquiowldotnotactivenothover0 2px ff3a2dbulletsfillinblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baanownew datevar mynowgettimenownewtimerrunning1var xnew datevartimeridnullvarxnew datevar20pxowldotactivedesoctobre 2017startclockstopclockshowtimettc contacteznouscrationvosdocumentaddeventlistenerdomcontentloadedfunctionstartclockfunction2017 lirecartes2px ff3a2dbulletsfillinblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baaowldotvarfunction showtimevar nownewspanbackgroundff3a2dboxshadownonebulletsstrokeblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baanewmynowgettimenownew datemydiffmstimeridsettimeoutshowtime10000timerrunning0 functionnowxgettimevar gmt16183909131000varvar timeridnullvar timerrunning1vardatevar mynowgettimenownewspanboxshadowinsetimagedatemydiffmstimeridsettimeoutshowtime10000timerrunning0

Longtail Keyword Density for Tierr.fr

KeywordsOccurences
2017 lire larticle9
opens in new6
0 0 2px4
prix ttc contactez-nouscration4
datevar mynowgettimenownew datemy-diffmstimeridsettimeoutshowtime10000timerrunning03
datevar nowxgettimevar gmt16183909131000var3
xnew datevar nowxgettimevar3
timerrunning1var xnew datevar3
timeridnullvar timerrunning1var xnew3
var timeridnullvar timerrunning1var3
startclockstopclockshowtime var timeridnullvar3
function startclockstopclockshowtime var3
datemy-diffmstimeridsettimeoutshowtime10000timerrunning0 function startclockstopclockshowtime3
mynowgettimenownew datemy-diffmstimeridsettimeoutshowtime10000timerrunning0 function3
function showtimevar nownew3
nownew datevar mynowgettimenownew3
showtimevar nownew datevar3
stopclockiftimerrunningcleartimeouttimeridtimerrunning1 function showtimevar3
documentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1 function3
octobre 2017 lire3
0 0 03
spanbox-shadowinset 0 03
0 2px ff3a2dbullets-fill-inblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
all and -ms-high-contrastnoneblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
cartes de visite3
contactez-nouscration de votre3
nowxgettimevar gmt16183909131000var diffmsnow-gmt3
0 013
2017 lire10
lire larticle9
page opens6
sur le4
prix ttc4
ttc contactez-nouscration4
0 2px4
pour les4
timeridnullvar timerrunning1var3
startclockstopclockshowtime var3
var timeridnullvar3
datevar nowxgettimevar3
timerrunning1var xnew3
xnew datevar3
datemy-diffmstimeridsettimeoutshowtime10000timerrunning0 function3
nowxgettimevar gmt16183909131000var3
gmt16183909131000var diffmsnow-gmt3
function startclockstopclockshowtime3
function showtimevar3
mynowgettimenownew datemy-diffmstimeridsettimeoutshowtime10000timerrunning03
datevar mynowgettimenownew3
nownew datevar3
showtimevar nownew3
stopclockiftimerrunningcleartimeouttimeridtimerrunning1 function3
documentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning13
octobre 20173
spanbox-shadowinset 03
2px ff3a2dbullets-fill-inblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
web et3
site web3
028
et24
votre21
owl-nav19
les19
des18
pour17
un13
blog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa13
une12
qui11
110
lire10
le9
larticle9
web7
est7
page7
ou7
var6
new6
function6
owl-dotnotactivehover6
datevar6
sur6
vos6
opens6
pas6
owl-dotactive5
all5
screen5
20px5
dans5
communication5
site5
vous5
formation4
aussi4
que4
image4
2px4
photoshop4
owl-dotnotactivenothover4
owl-dot4
notre4
contactez-nouscration4
ttc4
prix4
starter4
graphique4
documentaddeventlistenerdomcontentloadedfunctionstartclockfunction3
stopclockiftimerrunningcleartimeouttimeridtimerrunning13
showtimevar3
diffmsnow-gmt3
timerrunning1var3
cmplz-slider3
nownew3
cookies3
gmt16183909131000var3
nowxgettimevar3
mynowgettimenownew3
datemy-diffmstimeridsettimeoutshowtime10000timerrunning03
xnew3
share3
timeridnullvar3
startclockstopclockshowtime3
23
octobre3
photos3
avec3
projet3
tre3
je3
visuel3
plus3
ne3
nous3
cartes3
spanbackgroundff3a2dbox-shadownonebullets-etefublog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
visite3
flyers3
no-img3
blog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baacentered-layout-list3
-ms-high-contrastnoneblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
spanbackgroundff3a2dbox-shadownonebullets-strokeblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
ff3a2dbullets-fill-inblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa3
spanbox-shadowinset3
commentaire3

Who hosts Tierr.fr?

Tierr.fr Hosting Provider Information

Hosted IP Address:213.186.33.2
Hosted Hostname:cluster002.ovh.net
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:Apache

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
OVH SAS
1.0882%

HTTP Header Analysis for Tierr.fr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 14 Apr 2021 09:10:30 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Apache
X-Powered-By: PHP/7.4
Cache-Control: no-cache
Content-Encoding: gzip
WPO-Cache-Status: cached
Last-Modified: Wed, 14 Apr 2021 09:01:53 GMT

Tierr.fr Domain Nameserver Information

HostIP AddressCountry
dns15.ovh.net 213.251.188.134
ns15.ovh.net 213.251.128.134


Need to find out who hosts Tierr.fr?


Domain Registration (WhoIs) information for Tierr.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [52.56.39.231 REQUEST] >> tierr.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: tierr.fr
status: ACTIVE
hold: NO
holder-c: ANO00-FRNIC
admin-c: ANO00-FRNIC
tech-c: OVH5-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL22817-FRNIC
dsl-id: SIGN2173912-FRNIC
registrar: OVH
Expiry Date: 2021-05-24T05:45:04Z
created: 2006-06-23T14:49:34Z
last-update: 2021-03-22T17:48:14Z
source: FRNIC

ns-list: NSL22817-FRNIC
nserver: dns15.ovh.net
nserver: ns15.ovh.net
source: FRNIC

ds-list: SIGN2173912-FRNIC
key1-tag: 1749
key1-algo: 7 [RSASHA1-NSEC3-SHA1]
key1-dgst-t: 2 [SHA-256]
key1-dgst: BDDD94D190077999F1CC334D5E8459ECF2EBA4954461A6E1014F6283BED8F3E6
source: FRNIC

registrar: OVH
type: Isp Option 1
address: 2 Rue Kellermann
address: 59100 ROUBAIX
country: FR
phone: +33 8 99 70 17 61
fax-no: +33 3 20 20 09 58
e-mail: Login to show email
http://www.ovh.com
anonymous: NO
registered: 1999-10-21T12:00:00Z
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
remarks: While the registrar knows him/her,
remarks: this person chose to restrict access
remarks: to his/her personal data. So PLEASE,
remarks: don't send emails to Ano Nymous. This
remarks: address is bogus and there is no hope
remarks: of a reply.
remarks: -------------- WARNING --------------
registrar: OVH
changed: 2020-04-20T20:36:24Z [email protected]
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
remarks: While the registrar knows him/her,
remarks: this person chose to restrict access
remarks: to his/her personal data. So PLEASE,
remarks: don't send emails to Ano Nymous. This
remarks: address is bogus and there is no hope
remarks: of a reply.
remarks: -------------- WARNING --------------
registrar: OVH
changed: 2020-04-20T20:36:25Z [email protected]
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: OVH5-FRNIC
type: ROLE
contact: OVH NET
address: OVH
address: 140, quai du Sartel
address: 59100 Roubaix
country: FR
phone: +33 8 99 70 17 61
e-mail: Login to show email
Information: http://www.ovh.fr
trouble: Questions: Login to show email
Spam: Login to show email
OK217-FRNIC
tech-c: OK217-FRNIC
notify: Login to show email
OVH
changed: 2006-10-11T08:41:58Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

Tierr.art
tierr.art - Registered at Namecheap.com
Tierr.fr
TierrArt Créations, comment votre communication devient facile.
Tierra-21.hu
Magunkról | www.tierra-21.hu
Tierra-abierta.com
tierra-abierta.com - Registered at Namecheap.com
Tierra-abierta.net
tierra-abierta.net - Registered at Namecheap.com
Tierra-abierta.org
tierra-abierta.org - Registered at Namecheap.com
Tierra-adentro.cl
Tierra Adentro
Tierra-advisors.com
Tierra Advisors | Tierra Advisors
Tierra-aoi.net
Tierra aoi

Recently Updated Websites

Datasoftlogic.com (6 seconds ago.)Cestjeff.com (9 seconds ago.)Ameliadriversexperience.com (14 seconds ago.)Fuzzdata.com (16 seconds ago.)Bowlingfortruth.com (19 seconds ago.)Positivepowerco-op.com (21 seconds ago.)Geraldineclementcostumiere.com (22 seconds ago.)Marvelcoach.com (24 seconds ago.)Dierenwinkelxl.nl (24 seconds ago.)Coachyou.net (25 seconds ago.)Advanced5x5.com (30 seconds ago.)Multisploit.com (33 seconds ago.)Kiakova.com (34 seconds ago.)Emergencygrass.services (36 seconds ago.)Tedbrannon.org (37 seconds ago.)Binderintegratedhealthcenter.com (39 seconds ago.)Qianyuanshijie.com (42 seconds ago.)Fine-game.org (45 seconds ago.)Copyrgiardinaggio.it (46 seconds ago.)Socialecommerce.org (47 seconds ago.)Muaythai.org.tr (49 seconds ago.)Fapvis.com (49 seconds ago.)Alexachiropractic.com (51 seconds ago.)A-zinternational.com (55 seconds ago.)Mois.com (56 seconds ago.)Leonardolanzolla.com (57 seconds ago.)Thewelshagency.com (58 seconds ago.)Kinesisfilms.net (1 minute 3 seconds ago.)The50-50warrior.com (1 minute 4 seconds ago.)Eromap.net (1 minute 7 seconds ago.)

Recently Searched Keywords

bedminster cafe (1 second ago.)note room (1 second ago.)pinterest-75,299 (1 second ago.)bộ bé gái (2 seconds ago.)kelela (2 seconds ago.)situs judi slot online terbesar (2 seconds ago.)apfelwein (2 seconds ago.)dsm (3 seconds ago.)open wishlist page (3 seconds ago.)jawatankosong (3 seconds ago.)ms rarr (4 seconds ago.)exotictales (4 seconds ago.)eligible moorestown new (4 seconds ago.)arizona diamondbacks stadium (5 seconds ago.)185,000 đ (20) áo khoác gió phối màu sành điệu cho bé trai (5 seconds ago.)продукти для діабетиків (5 seconds ago.)for the culture (6 seconds ago.)snovitra power 100 mg (6 seconds ago.)parseintthisfindcontentmargincssmargin-right var ml (6 seconds ago.)199,000 đ (70) bộ thun chữ m và quần jogger cho bé trai và gái (6 seconds ago.)visitoridcookiedata (7 seconds ago.)cowboy action (7 seconds ago.)patent law (7 seconds ago.)180,000 đ (175) bộ thun phong cách thể thao snhr cực ngầu cho bé trai (7 seconds ago.)325,000 đ (70) áo len cao cấp thu-đông zvz cho bé trai (8 seconds ago.)grandfathermountain (8 seconds ago.)first-row (8 seconds ago.)penon cream (9 seconds ago.)social video  (9 seconds ago.)nitroliveicecreamery (10 seconds ago.)