Tierr.frTierr.fr

TierrArt Créations, comment votre communication devient facile.

Safety: Low trust score

Year Founded: 2006

Global Traffic Rank: Unknown

Estimated Worth: $9

Category: This site has not been categorized yet

Expand details Add category Claim this site

Illustrateur et infographiste en freelance, je travaille en communication visuelle, pour l’édition, les PME, les indépendants, le web et l’audiovisuel. Auteur de bandes dessinées, mattepainter et peintre numérique, mes compétences sont appréciées dans la recherche graphique et la conception de séquences et de décors. Formateur indépendant sur Ad...

tierr

Useful Searches

tierra del fuego

tierra whack

tierra marble

tierra

tierra de reyes

tierra vista general trias

tierranet

tierra vista

tierra atacama

tierra alta dumaguete

Domain summary

Last updated	2021-04-14
Domain label	tierr
Domain extension	fr
Domain registered:	2006-06-23
Domain updated:	2021-03-22
Global Traffic Rank	0
Statvoo Rating	I
Trust Score	Low Trust Score
Estimated worth	$9
Estimated daily income	$0
Estimated monthly income	$0

Frequently Asked Questions (FAQ)

Q: When was Tierr.fr registered?

A: Tierr.fr was registered 15 years, 5 months, 1 week, 3 days, 20 hours, 43 minutes, 19 seconds ago on Friday, June 23, 2006.

Q: When was the WHOIS for Tierr.fr last updated?

A: The WHOIS entry was last updated 8 months, 1 week, 5 days, 20 hours, 43 minutes, 19 seconds ago on Monday, March 22, 2021.

Q: What are Tierr.fr's nameservers?

A: DNS for Tierr.fr is provided by the following nameservers:

dns15.ovh.net
ns15.ovh.net

Q: Who is the registrar for the Tierr.fr domain?

A: The domain has been registered at AFNIC.

Q: What is the traffic rank for Tierr.fr?

A: Tierr.fr has a Low Trust Score, and a Statvoo Rank of I.

Q: How many people visit Tierr.fr each day?

A: Tierr.fr receives approximately 0 visitors and 0 page impressions per day.

Q: What IP address does Tierr.fr resolve to?

A: Tierr.fr resolves to the IPv4 address 213.186.33.2.

Q: In what country are Tierr.fr servers located in?

A: Tierr.fr has servers located in the France.

Q: What webserver software does Tierr.fr use?

A: Tierr.fr is powered by Apache webserver.

Q: Who hosts Tierr.fr?

A: Tierr.fr is hosted by OVH SAS in France.

Q: How much is Tierr.fr worth?

A: Tierr.fr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Tierr.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Tierr.fr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Tierr.fr

H1 Headings

2 :

BIENVENUE SUR LE SITE DE
Créateurs d’entreprises

H2 Headings

5 :

Les bases de la communication
La communication PRO
Pour réussir votre évènementiel
La solution pour être vu
Coordonnées :

H3 Headings

21 :

Pour être connu, vous devez être vu.
Alors, laissez-nous traduire avec esthétisme et originalité votre projet
Illustrateur et infographiste en freelance, je travaille en communication visuelle, pour l’édition, les PME, les indépendants, le web et l’audiovisuel.
Auteur de bandes dessinées, mattepainter et peintre numérique, mes compétences sont appréciées dans la recherche graphique et la conception de séquences et de décors.
Formateur indépendant sur Adobe Photoshop et Corel Painter, je dispense des cours en photomontage et mattepainting, dans des centres de formation et en université.
Parce qu’il est important de vous démarquer et d’affirmer votre identité
Nous avons conçu pour vous des packs de communication essentiels
SOLO STARTER KIT
BUSINESS STARTER KIT
ÉVÈNEMENT STARTER KIT
PRINTWEB STARTER KIT
Edeka, des pubs pas comme les autres
Nouveautés de Photoshop CC 2018
Transformer vos photos couleur en photos noir & blanc intense
Tutoriel Photoshop – Styles de calques additifs
L’univers morbide et déjanté de Sabbas Apterus
Template Photoshop, effet bande dessinée
Corel PAINTER 2018, les nouveautés.
La licence professionnelle ATC design numérique 2017 à l’IUT de Corse
Template Photoshop pour un effet de peinture aquarelle.
L’art d’Adam Brockbank

H4 Headings

11 :

IDENTITÉ VISUELLE
COMMUNICATION
ILLUSTRATION
BANDE DESSINÉE
MATTE PAINTING
PHOTO MONTAGE
WEB DESIGN
FORMATION
ADRESSE POSTALE :
TÉLÉPHONE :
EMAIL :

H5 Headings

4 :

Un renseignement, un devis, une demande de formation, un bonjour, n’hésitez pas à nous contacter.
12, rue de la Grille 10100 Romilly-sur-Seine – FRANCE
(+33) 06 66 40 68 90
Formulaire de contact

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

44 :

Google Adsense

Not Applicable

Google Analytics

UA-50620933-1

Links - Internal

60:

Show 55 more items

Links - Internal (nofollow)

10:

Show 5 more items

Links - Outbound

11:

Show 6 more items

Links - Outbound (nofollow)

Keyword Cloud for Tierr.fr

opensowldotnotactivehoverque1var timeridnullvarxnew datevar nowxgettimevarlesvotrenownew datevarlarticlescreenvisitestarterprix ttcpour lesnowxgettimevar gmt16183909131000var diffmsnowgmtcommunicationphotosplusopens in newspanboxshadowinset 0 0startclockstopclockshowtime varweb etnownewblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baasurdatemydiffmstimeridsettimeoutshowtime10000timerrunning0 function startclockstopclockshowtimecommentairedatevar nowxgettimevar gmt16183909131000vardatevar mynowgettimenownew datemydiffmstimeridsettimeoutshowtime10000timerrunning0xnewgmt16183909131000varsur leprojet2017 lire larticleff3a2dbulletsfillinblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baagraphiquetimerrunning1var xnewavecdatemydiffmstimeridsettimeoutshowtime10000timerrunning0 functionvisuelsite weblire larticleowlnavstopclockiftimerrunningcleartimeouttimeridtimerrunning1 functionmynowgettimenownew0 0function startclockstopclockshowtimeprixshowtimevarnowxgettimevarvouscmplzslider0 0 2pxtrefunctionmshighcontrastnoneblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baaetsitepageall and mshighcontrastnoneblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baapage openstimeridnullvar timerrunning1varoctobreaussinespanbackgroundff3a2dboxshadownonebulletsetefublogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baa0 2pxestune2lirestopclockiftimerrunningcleartimeouttimeridtimerrunning1 function showtimevarformationcontacteznouscration0timerrunning1vartimeridnullvar timerrunning1var xnew2pxblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baacenteredlayoutlistjedansshowtimevar nownew datevarnoimgmynowgettimenownew datemydiffmstimeridsettimeoutshowtime10000timerrunning0documentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1 functionprix ttc contacteznouscrationgmt16183909131000var diffmsnowgmtdatevar nowxgettimevarspanboxshadowinset 0photoshopdocumentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1passharepourlestartclockstopclockshowtime var timeridnullvarttcfunction showtimevarwebstopclockiftimerrunningcleartimeouttimeridtimerrunning1contacteznouscration de votrenousoctobre 2017 liredatevarcookiesnotreflyers0 0 0diffmsnowgmtcartes de visiteunfunction startclockstopclockshowtime varouallshowtimevar nownewquiowldotnotactivenothover0 2px ff3a2dbulletsfillinblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baanownew datevar mynowgettimenownewtimerrunning1var xnew datevartimeridnullvarxnew datevar20pxowldotactivedesoctobre 2017startclockstopclockshowtimettc contacteznouscrationvosdocumentaddeventlistenerdomcontentloadedfunctionstartclockfunction2017 lirecartes2px ff3a2dbulletsfillinblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baaowldotvarfunction showtimevar nownewspanbackgroundff3a2dboxshadownonebulletsstrokeblogcarouselshortcodeblogcarouselshortcodeid538eee8f6ef2ef3c7d0ed14ed4003baanewmynowgettimenownew datemydiffmstimeridsettimeoutshowtime10000timerrunning0 functionnowxgettimevar gmt16183909131000varvar timeridnullvar timerrunning1vardatevar mynowgettimenownewspanboxshadowinsetimagedatemydiffmstimeridsettimeoutshowtime10000timerrunning0

Longtail Keyword Density for Tierr.fr

Keywords	Occurences
2017 lire larticle	9
opens in new	6
0 0 2px	4
prix ttc contactez-nouscration	4
datevar mynowgettimenownew datemy-diffmstimeridsettimeoutshowtime10000timerrunning0	3
datevar nowxgettimevar gmt16183909131000var	3
xnew datevar nowxgettimevar	3
timerrunning1var xnew datevar	3
timeridnullvar timerrunning1var xnew	3
var timeridnullvar timerrunning1var	3
startclockstopclockshowtime var timeridnullvar	3
function startclockstopclockshowtime var	3
datemy-diffmstimeridsettimeoutshowtime10000timerrunning0 function startclockstopclockshowtime	3
mynowgettimenownew datemy-diffmstimeridsettimeoutshowtime10000timerrunning0 function	3
function showtimevar nownew	3
nownew datevar mynowgettimenownew	3
showtimevar nownew datevar	3
stopclockiftimerrunningcleartimeouttimeridtimerrunning1 function showtimevar	3
documentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1 function	3
octobre 2017 lire	3
0 0 0	3
spanbox-shadowinset 0 0	3
0 2px ff3a2dbullets-fill-inblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
all and -ms-high-contrastnoneblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
cartes de visite	3
contactez-nouscration de votre	3
nowxgettimevar gmt16183909131000var diffmsnow-gmt	3
0 0	13
2017 lire	10
lire larticle	9
page opens	6
sur le	4
prix ttc	4
ttc contactez-nouscration	4
0 2px	4
pour les	4
timeridnullvar timerrunning1var	3
startclockstopclockshowtime var	3
var timeridnullvar	3
datevar nowxgettimevar	3
timerrunning1var xnew	3
xnew datevar	3
datemy-diffmstimeridsettimeoutshowtime10000timerrunning0 function	3
nowxgettimevar gmt16183909131000var	3
gmt16183909131000var diffmsnow-gmt	3
function startclockstopclockshowtime	3
function showtimevar	3
mynowgettimenownew datemy-diffmstimeridsettimeoutshowtime10000timerrunning0	3
datevar mynowgettimenownew	3
nownew datevar	3
showtimevar nownew	3
stopclockiftimerrunningcleartimeouttimeridtimerrunning1 function	3
documentaddeventlistenerdomcontentloadedfunctionstartclockfunction stopclockiftimerrunningcleartimeouttimeridtimerrunning1	3
octobre 2017	3
spanbox-shadowinset 0	3
2px ff3a2dbullets-fill-inblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
web et	3
site web	3
0	28
et	24
votre	21
owl-nav	19
les	19
des	18
pour	17
un	13
blog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	13
une	12
qui	11
1	10
lire	10
le	9
larticle	9
web	7
est	7
page	7
ou	7
var	6
new	6
function	6
owl-dotnotactivehover	6
datevar	6
sur	6
vos	6
opens	6
pas	6
owl-dotactive	5
all	5
screen	5
20px	5
dans	5
communication	5
site	5
vous	5
formation	4
aussi	4
que	4
image	4
2px	4
photoshop	4
owl-dotnotactivenothover	4
owl-dot	4
notre	4
contactez-nouscration	4
ttc	4
prix	4
starter	4
graphique	4
documentaddeventlistenerdomcontentloadedfunctionstartclockfunction	3
stopclockiftimerrunningcleartimeouttimeridtimerrunning1	3
showtimevar	3
diffmsnow-gmt	3
timerrunning1var	3
cmplz-slider	3
nownew	3
cookies	3
gmt16183909131000var	3
nowxgettimevar	3
mynowgettimenownew	3
datemy-diffmstimeridsettimeoutshowtime10000timerrunning0	3
xnew	3
share	3
timeridnullvar	3
startclockstopclockshowtime	3
2	3
octobre	3
photos	3
avec	3
projet	3
tre	3
je	3
visuel	3
plus	3
ne	3
nous	3
cartes	3
spanbackgroundff3a2dbox-shadownonebullets-etefublog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
visite	3
flyers	3
no-img	3
blog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baacentered-layout-list	3
-ms-high-contrastnoneblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
spanbackgroundff3a2dbox-shadownonebullets-strokeblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
ff3a2dbullets-fill-inblog-carousel-shortcodeblog-carousel-shortcode-id-538eee8f6ef2ef3c7d0ed14ed4003baa	3
spanbox-shadowinset	3
commentaire	3

Who hosts Tierr.fr?

Tierr.fr Hosting Provider Information

Hosted IP Address:	213.186.33.2
Hosted Hostname:	cluster002.ovh.net
Service Provider:	OVH SAS
Hosted Country:	FR
Location Latitude:	48.8582
Location Longitude:	2.3387
Webserver Software:	Apache

Is "OVH SAS" in the Top 10 Hosting Companies?

Name

Percentage

Unknown

18.1104%

GOOGLE

13.7558%

AS-26496-GO-DADDY-COM-LLC

3.6367%

NAMECHEAP-NET

3.0541%

AMAZON-AES

2.2094%

GoDaddy.com, LLC

2.0363%

UNIFIEDLAYER-AS-1

1.9078%

Fara Negar Pardaz Khuzestan

1.5654%

CONFLUENCE-NETWORK-INC

1.4231%

1&1 Internet AG

1.3177%

OVH SAS

1.0882%

HTTP Header Analysis for Tierr.fr

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Date:	Wed, 14 Apr 2021 09:10:30 GMT
Content-Type:	text/html; charset=UTF-8
Transfer-Encoding:	chunked
Connection:	keep-alive
Server:	Apache
X-Powered-By:	PHP/7.4
Cache-Control:	no-cache
Content-Encoding:	gzip
WPO-Cache-Status:	cached
Last-Modified:	Wed, 14 Apr 2021 09:01:53 GMT

Tierr.fr Domain Nameserver Information

Host	IP Address	Country
dns15.ovh.net	213.251.188.134
ns15.ovh.net	213.251.128.134

Need to find out who hosts Tierr.fr?

Domain Registration (WhoIs) information for Tierr.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [52.56.39.231 REQUEST] >> tierr.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: tierr.fr
status: ACTIVE
hold: NO
holder-c: ANO00-FRNIC
admin-c: ANO00-FRNIC
tech-c: OVH5-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL22817-FRNIC
dsl-id: SIGN2173912-FRNIC
registrar: OVH
Expiry Date: 2021-05-24T05:45:04Z
created: 2006-06-23T14:49:34Z
last-update: 2021-03-22T17:48:14Z
source: FRNIC

ns-list: NSL22817-FRNIC
nserver: dns15.ovh.net
nserver: ns15.ovh.net
source: FRNIC

ds-list: SIGN2173912-FRNIC
key1-tag: 1749
key1-algo: 7 [RSASHA1-NSEC3-SHA1]
key1-dgst-t: 2 [SHA-256]
key1-dgst: BDDD94D190077999F1CC334D5E8459ECF2EBA4954461A6E1014F6283BED8F3E6
source: FRNIC

registrar: OVH
type: Isp Option 1
address: 2 Rue Kellermann
address: 59100 ROUBAIX
country: FR
phone: +33 8 99 70 17 61
fax-no: +33 3 20 20 09 58
e-mail: Login to show email
 http://www.ovh.com
anonymous: NO
registered: 1999-10-21T12:00:00Z
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
remarks: While the registrar knows him/her,
remarks: this person chose to restrict access
remarks: to his/her personal data. So PLEASE,
remarks: don't send emails to Ano Nymous. This
remarks: address is bogus and there is no hope
remarks: of a reply.
remarks: -------------- WARNING --------------
registrar: OVH
changed: 2020-04-20T20:36:24Z [email protected]
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
remarks: While the registrar knows him/her,
remarks: this person chose to restrict access
remarks: to his/her personal data. So PLEASE,
remarks: don't send emails to Ano Nymous. This
remarks: address is bogus and there is no hope
remarks: of a reply.
remarks: -------------- WARNING --------------
registrar: OVH
changed: 2020-04-20T20:36:25Z [email protected]
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: OVH5-FRNIC
type: ROLE
contact: OVH NET
address: OVH
address: 140, quai du Sartel
address: 59100 Roubaix
country: FR
phone: +33 8 99 70 17 61
e-mail: Login to show email
 Information: http://www.ovh.fr
trouble: Questions: Login to show email
 Spam: Login to show email
 OK217-FRNIC
tech-c: OK217-FRNIC
notify: Login to show email
 OVH
changed: 2006-10-11T08:41:58Z Login to show email
 NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

Tierr.art
tierr.art - Registered at Namecheap.com

Tierr.fr
TierrArt Créations, comment votre communication devient facile.

Tierra-21.hu
Magunkról | www.tierra-21.hu

Tierra-abierta.com
tierra-abierta.com - Registered at Namecheap.com

Tierra-abierta.net
tierra-abierta.net - Registered at Namecheap.com

Tierra-abierta.org
tierra-abierta.org - Registered at Namecheap.com

Tierra-adentro.cl
Tierra Adentro

Tierra-advisors.com
Tierra Advisors | Tierra Advisors

Tierra-aoi.net
Tierra aoi

Tierra-armada.com
Portada

Recently Searched Keywords

bedminster cafe (1 second ago.), note room (1 second ago.), pinterest-75,299 (1 second ago.), bộ bé gái (2 seconds ago.), kelela (2 seconds ago.), situs judi slot online terbesar (2 seconds ago.), apfelwein (2 seconds ago.), dsm (3 seconds ago.), open wishlist page (3 seconds ago.), jawatankosong (3 seconds ago.), ms rarr (4 seconds ago.), exotictales (4 seconds ago.), eligible moorestown new (4 seconds ago.), arizona diamondbacks stadium (5 seconds ago.), 185,000 đ (20) áo khoác gió phối màu sành điệu cho bé trai (5 seconds ago.), продукти для діабетиків (5 seconds ago.), for the culture (6 seconds ago.), snovitra power 100 mg (6 seconds ago.), parseintthisfindcontentmargincssmargin-right var ml (6 seconds ago.), 199,000 đ (70) bộ thun chữ m và quần jogger cho bé trai và gái (6 seconds ago.), visitoridcookiedata (7 seconds ago.), cowboy action (7 seconds ago.), patent law (7 seconds ago.), 180,000 đ (175) bộ thun phong cách thể thao snhr cực ngầu cho bé trai (7 seconds ago.), 325,000 đ (70) áo len cao cấp thu-đông zvz cho bé trai (8 seconds ago.), grandfathermountain (8 seconds ago.), first-row (8 seconds ago.), penon cream (9 seconds ago.), social video (9 seconds ago.), nitroliveicecreamery (10 seconds ago.),