TimeSale - Выгодный обмен

Safety: Low trust score
Year Founded: 2017
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-12-03
Category: This site has not been categorized yet

TimeSale - сервис обмена электронных валют. Многолетний опыт финансовых операций. Несколько тысяч довольных клиентов. 100% надёжность обмена. Лучшие курсы на обмен Qiwi, Приват24, Сбербанк рубля, Payeer, Яндекс.Деньги и других валют. С нами быстро, удобно, надёжно!


Domain summary

Domain label
timesale
Domain extension
su
Domain registered:
2017-06-15
Domain updated:
2020-12-03
Domain expires:
2021-06-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is timesale.su ranked relative to other sites:

Percentage of visits to timesale.su from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Timesale.su registered?
A: Timesale.su was registered 3 years, 7 months, 1 week, 4 days, 2 hours, 4 minutes, 27 seconds ago on Thursday, June 15, 2017.
Q: When was the WHOIS for Timesale.su last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 2 days, 2 hours, 4 minutes, 27 seconds ago on Thursday, December 3, 2020.
Q: What are Timesale.su's nameservers?
A: DNS for Timesale.su is provided by the following nameservers:
  • simon.ns.cloudflare.com
  • tricia.ns.cloudflare.com
Q: Who is the registrar for the Timesale.su domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Timesale.su?
A: Timesale.su has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Timesale.su each day?
A: Timesale.su receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Timesale.su resolve to?
A: Timesale.su resolves to the IPv4 address 172.67.151.113.
Q: In what country are Timesale.su servers located in?
A: Timesale.su has servers located in the United States.
Q: What webserver software does Timesale.su use?
A: Timesale.su is powered by CloudFlare webserver.
Q: Who hosts Timesale.su?
A: Timesale.su is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Timesale.su worth?
A: Timesale.su has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Timesale.su Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Timesale.su Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Timesale.su

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

1 :
  1. УВЕДОМЛЕНИЕ ОБ ОТВЕТСТВЕННОСТИ

H6 Headings

1 :
  1. Резервы валют

Total IFRAMEs

0 :

Total Images

48 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

25:

Links - Outbound (nofollow)

0:

Keyword Cloud for Timesale.su

content contentdocumentlocationreload completeerrorsolutionfunction pastedvaluefunction data clearintervalupdaterate09azazofflineif currentprogressloadindicatorremoveclassdnonedatatype post urlkeyrubdisabled true addclassdisabledjson datapastedvaluereplacemailto definitionsvaluewebmoney transfer webmoneydocumentlocationreloadvarclearintervalupdateratetransferfunction documentlocationreload completerateinhtmldatasuccessrateinfalse greedytether1post urlcompleteslidestoscrollsuccess functionupdaterategetticketrate7complete functionelse returnpostselectpaysystemoutvaladvancedcasing lowerkey valuediscountrateinhtmldatasuccessratein rateouthtmldatasuccessrateoutsettings slidestoshowsetintervalfunctiondata directionticketbodyheightdirection selectpaysystemoutvalrateouthtmldatasuccessrateoutpastedvalue pastedvaluetolowercase returnpastedvaluetruepastedvaluetolowercase return pastedvaluereplacemailtoreturn pastedvaluereplacemailto definitionsdata direction selectpaysystemoutvaldata clearintervalupdateratelshowmaskonhover falsefunctionkeyaveragecard htmlfalseslidestoshowadvanced cashcouponformshowpastedvalue optsdocumentdata clearintervalupdaterate clearintervalbarnullfunction key valuegreedy false onbeforepasteajax type postcontentfalse onbeforepasteeajaxsettingsfunction varsuccess function dataonbeforepaste function pastedvalueurl09azaz casing lowercoursespanelcssheightdocumentlocationreload complete functionfunction updaterate setintervalfunctionvalidator 09azaz casingcasingdisabled true0commissionpastedvaluetolowercase returnclearintervalupdaterate clearintervalbarwidthonbeforepastegreedyticketalerthtmlhidefunction updateratedatatype json datafalse onbeforepaste function25dgethoursdatatypeselectpaysystemoutselectpickerrefreshlowertype postcoursespanelcssheight ticketbodyheightdirectiontrue addclassdisabledshowmaskonhover false greedyethereumuahincomingaccount419 function documentlocationreloadbitcoinopts pastedvalue pastedvaluetolowercaseajax typepastedvaluetolowercasetimesalesuccessstatuscodedefinitions validator 09azazaveragecardopts pastedvaluestatuscode 419showmaskonhoverelsestatuscode 419 functionreturn pastedvaluereplacemailtohtmlvalidator 09azazpastedvalue pastedvaluetolowercase09azaz casinggreedy falsetypetransfer webmoneyupdaterate setintervalfunction419 functionfunction keystartprogressbarclearintervalbar3onbeforepaste function4currentprogresspastedvaluereplacemailtoloyaltyformhideemailpastedvaluereplacemailto definitions validatordefinitionspayeerqiwifunction6cashjson data directiondatatype jsonjsonpastedvalue opts pastedvaluewebmoney transferbreakpointfunction ecomplete function updaterateinputcouponvalfalse greedy falsefunctionkey valuereturniffunction data01webmoneydefinitions validatordisabledtemporaryticketmoneyaddclassdisabledoptsfunction documentlocationreloadfunction pastedvalue optsvalidatorsearchaccount

Longtail Keyword Density for Timesale.su

KeywordsOccurences
ajax type post9
type post url9
success function data9
datatype json data8
statuscode 419 function6
419 function documentlocationreload6
disabled true addclassdisabled5
0-9a-za-z- casing lower4
validator 0-9a-za-z- casing4
definitions validator 0-9a-za-z-4
pastedvaluereplacemailto definitions validator4
return pastedvaluereplacemailto definitions4
pastedvaluetolowercase return pastedvaluereplacemailto4
pastedvalue pastedvaluetolowercase return4
opts pastedvalue pastedvaluetolowercase4
pastedvalue opts pastedvalue4
function pastedvalue opts4
onbeforepaste function pastedvalue4
false onbeforepaste function4
greedy false onbeforepaste4
false greedy false3
showmaskonhover false greedy3
function key value3
documentlocationreload complete function3
function documentlocationreload complete3
json data direction3
data direction selectpaysystemoutval3
function data clearintervalupdaterate3
data clearintervalupdaterate clearintervalbar3
complete function updaterate3
function updaterate setintervalfunction3
webmoney transfer webmoney3
type post9
ajax type9
post url9
datatype json9
success function9
function data9
json data8
419 function6
function documentlocationreload6
complete function6
clearintervalupdaterate clearintervalbar6
statuscode 4196
function e5
advanced cash5
disabled true5
true addclassdisabled5
pastedvalue opts4
casing lower4
0-9a-za-z- casing4
validator 0-9a-za-z-4
definitions validator4
pastedvaluereplacemailto definitions4
return pastedvaluereplacemailto4
pastedvaluetolowercase return4
pastedvalue pastedvaluetolowercase4
opts pastedvalue4
onbeforepaste function4
function pastedvalue4
false onbeforepaste4
greedy false4
showmaskonhover false4
content content4
averagecard html4
functionkey value3
if currentprogress3
else return3
transfer webmoney3
function var3
coursespanelcssheight ticketbodyheight3
updaterate setintervalfunction3
function updaterate3
data clearintervalupdaterate3
rateinhtmldatasuccessratein rateouthtmldatasuccessrateout3
webmoney transfer3
direction selectpaysystemoutval3
data direction3
documentlocationreload complete3
function key3
key value3
false greedy3
settings slidestoshow3
function52
if32
var20
else20
data17
false16
return14
true12
012
json11
url11
110
type10
temporaryticket10
html9
success9
ajax9
datatype9
post9
clearintervalbar8
pastedvalue8
content8
complete7
value7
e7
disabled7
documentlocationreload7
clearintervalupdaterate7
qiwi7
currentprogress7
26
rub6
statuscode6
advanced5
addclassdisabled5
setintervalfunction5
width5
payeer5
cash5
coursespanelcssheight4
getticketrate4
showmaskonhover4
lower4
pastedvaluereplacemailto4
casing4
greedy4
onbeforepaste4
0-9a-za-z-4
validator4
opts4
definitions4
pastedvaluetolowercase4
offline4
error4
null4
tether4
34
money4
44
54
slidestoscroll4
updaterate4
slidestoshow4
webmoney4
averagecard4
dgethours4
l4
ticketalerthtmlhide4
incomingaccount3
discount3
loadindicatorremoveclassd-none3
commission3
ticketbodyheight3
loyaltyformhide3
breakpoint3
63
functionkey3
couponformshow3
key3
rateouthtmldatasuccessrateout3
document3
73
bitcoin3
ethereum3
uah3
e-mail3
transfer3
solution3
searchaccount3
rateinhtmldatasuccessratein3
timesale3
selectpaysystemoutselectpickerrefresh3
inputcouponval3
startprogressbar3
013
direction3
selectpaysystemoutval3
settings3

Who hosts Timesale.su?

Timesale.su Hosting Provider Information

Hosted IP Address:172.67.151.113
Hosted Hostname:172.67.151.113
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
T-Mobile USA, Inc.
0.8767%

HTTP Header Analysis for Timesale.su

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 03 Dec 2020 04:13:06 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-cache, private
X-Frame-Options: SAMEORIGIN
CF-Cache-Status: DYNAMIC
cf-request-id: 06c866d4ff0000bb8eeeaf7000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=rL8C+L194ruSgMlJw7m1IMXMBYJYPhxXFEELEdK1KjC2fGlUMIFK0r7HLv6P3aNH6j+5WFnDy7TpZkGNzt8CjSBYN4CfLIpk4TUvrA=="}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5fba74019f2fbb8e-LHR
Content-Encoding: gzip

Timesale.su Domain Nameserver Information

HostIP AddressCountry
simon.ns.cloudflare.com 173.245.59.232
tricia.ns.cloudflare.com 173.245.58.232


Need to find out who hosts Timesale.su?


Domain Registration (WhoIs) information for Timesale.su

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: TIMESALE.SU
nserver: simon.ns.cloudflare.com.
nserver: tricia.ns.cloudflare.com.
state: REGISTERED, DELEGATED
person: Private Person
e-mail: Login to show email
REGRU-SU
created: 2017-06-15T13:06:10Z
paid-till: 2021-06-15T13:06:10Z
free-date: 2021-07-18
source: TCI

Last updated on 2020-12-03T04:11:30Z

Websites with Similar Names

Times-2remember.com
Times To Remember photography and videography services - Home
Times-argus.net
times-argus.net
Times-arrow.com
Time's Arrow - Designer Handbags and Leather Goods | Time's Arrow
Times-bd.com
Your Store
Times-bignews.com
PKV Games Situs Judi Online Terpercaya - IndoDewaQQ
Times-business.com
times-business.com - Registered at Namecheap.com
Times-cn.com
西安易信陪驾服务有限公司
Times-cz.com
Error 404 (Not Found)!!1
Times-e.com
张掖市时代网络科技有限责任公司 欢迎您!张掖企业培训、张掖营销策划、程序开发、网站建设
Times-ebooking.com
Apache HTTP Server Test Page powered by CentOS

Recently Updated Websites

Crazycoffeeproductions.com (2 seconds ago.)Carterfinancialplanning.com (6 seconds ago.)Christyhorner.com (6 seconds ago.)Cannabismediq.com (8 seconds ago.)Bilgisayarhurdaciniz.com (9 seconds ago.)Currencynewsfyi.com (9 seconds ago.)Cooperativecareers.com (10 seconds ago.)Colemanlanddevelopmentllc.com (11 seconds ago.)Coastruct.com (13 seconds ago.)Colorfulteaching.com (13 seconds ago.)Corestaffingsolutionsllc.com (17 seconds ago.)Clickvolumer.com (18 seconds ago.)Collectionproperty.com (19 seconds ago.)Createlicense.com (20 seconds ago.)Citruspins.com (21 seconds ago.)Droopywallet.app (21 seconds ago.)Covidstateu.com (25 seconds ago.)Ditandang.com (27 seconds ago.)Cricketandcodogspa.com (29 seconds ago.)Clueskin.com (29 seconds ago.)Bitterundboes.com (32 seconds ago.)Bluewatersignage.com (33 seconds ago.)Chelseachidolue.com (35 seconds ago.)Choosejoymindfulness.com (37 seconds ago.)Couriercanna.com (37 seconds ago.)Belleheather.com (37 seconds ago.)Bijouskitchen.com (38 seconds ago.)Cairobiopharma.com (43 seconds ago.)Blackwomeninleadershipnetwork.com (45 seconds ago.)Bigdadt.com (47 seconds ago.)

Recently Searched Keywords

videokameralar, əkşn-kameralar (1 second ago.)kostyumlar qiz ucun (1 second ago.)xəyallarınızdakı mətbəxi sizə daha yaxın edirik! (4 seconds ago.)rss feed aggregator (4 seconds ago.)animation-timing-function linear (4 seconds ago.)levha (5 seconds ago.)lion studio galle (7 seconds ago.)better sex (8 seconds ago.)читать далее (8 seconds ago.)residential design services (9 seconds ago.)wirz-see (v�rts j�rv) (11 seconds ago.)bail bondsman new york (12 seconds ago.)hand delivery (16 seconds ago.)tell the senate: end the rape kit backlog (17 seconds ago.)do you have what it takes to run a semi-absentee franchise (21 seconds ago.)tibbi mhsullar (22 seconds ago.)no saigo no (22 seconds ago.)almaqç onlayn ticarət mərkəzi (24 seconds ago.)animated-background animation-duration 1s (25 seconds ago.)trusted online pharmacies (25 seconds ago.)mhsullar (26 seconds ago.)sendit (26 seconds ago.)dropdown372863657dropdowncontent (26 seconds ago.)468px 0 (27 seconds ago.)imkan (28 seconds ago.)wytwornice pary (28 seconds ago.)-468px 0 100 (29 seconds ago.)televizor bakida almaq (30 seconds ago.)2020sami j (32 seconds ago.)shopping informer (33 seconds ago.)